BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0772 (707 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 5.0 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 5.0 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 8.7 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 22.2 bits (45), Expect = 5.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 64 VFLLKTMFDCQLMNSVIPA 8 +FLL MF+C ++ IP+ Sbjct: 605 LFLLLDMFNCVVVEETIPS 623 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/48 (18%), Positives = 23/48 (47%) Frame = +3 Query: 3 ARAGITEFINWQSNIVFKRKTKRISSLIKVINKITWVGSGLALPLALL 146 A +G+ F W+ ++ K + ++ + ++ W G + + L +L Sbjct: 25 AASGLRWFEIWRDSLPTKMRELNATACAALYERVEWSGPWILVTLIVL 72 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/31 (25%), Positives = 13/31 (41%) Frame = -3 Query: 672 DTTHWSFSPDLLSGSRFRSDDRFCEALLLLG 580 D HW + L GS+ + + L +G Sbjct: 439 DEAHWELEEESLQGSKIKESNSCSNDQLPMG 469 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,876 Number of Sequences: 438 Number of extensions: 3305 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -