BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0771 (699 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1669 + 28499143-28499409,28499915-28500055,28500528-285006... 28 8.2 >07_03_1669 + 28499143-28499409,28499915-28500055,28500528-28500659, 28501185-28501373,28501503-28501580,28502267-28502386, 28502701-28502818,28503012-28503280,28503428-28503622, 28503737-28503879,28504096-28504180,28504270-28504479, 28504559-28504711,28504862-28504966,28505044-28505235 Length = 798 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +2 Query: 119 SAHAVVLAENLFKYLITVSSLNLSRTEALYTDATIGVDTPFWLL 250 SAHAV + K L T + + + + L TDA++ + TPF+++ Sbjct: 80 SAHAVEREFQVLKALGTYTDVPVPKVFCLCTDASV-IGTPFYIM 122 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,726,628 Number of Sequences: 37544 Number of extensions: 339073 Number of successful extensions: 679 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 671 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 679 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -