BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0770 (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9647| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 28 8.6 SB_14972| Best HMM Match : UPF0066 (HMM E-Value=5.7) 28 8.6 >SB_9647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/41 (24%), Positives = 25/41 (60%) Frame = +3 Query: 435 ITRTQSSDTTKQTYYIHNPPTINNQCSRLLYYVTLPREGAT 557 + + +S++ ++ +YI P + +CSR +Y+ +P+ +T Sbjct: 76 VPKNRSTECSRSKHYIIVPKNRSTECSRSKHYIIVPKNRST 116 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 27.9 bits (59), Expect = 8.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 472 HITFTIRPQSTISAPDYYTT 531 H+TFTIR T+S P Y T Sbjct: 27 HLTFTIRTHPTLSKPSYTIT 46 >SB_14972| Best HMM Match : UPF0066 (HMM E-Value=5.7) Length = 465 Score = 27.9 bits (59), Expect = 8.6 Identities = 20/50 (40%), Positives = 27/50 (54%) Frame = +3 Query: 486 NPPTINNQCSRLLYYVTLPREGATSKTFSI*PRCLLGQPSPGCLIFISGI 635 N PT NQ SRL TL +G TS +++ C+L S IF+SG+ Sbjct: 410 NTPTSQNQDSRLGNTSTLALKGNTSLPYTL--PCILSDNSTP-YIFMSGL 456 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,148,248 Number of Sequences: 59808 Number of extensions: 442249 Number of successful extensions: 819 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 818 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -