BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0769 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 24 1.6 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 6.4 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 23.8 bits (49), Expect = 1.6 Identities = 13/63 (20%), Positives = 29/63 (46%) Frame = +3 Query: 81 KYLDPSRMADDIIFELLHSEIINYSIEKFKNNDNGEKETDLSVVEYIGFAAGYKIMER*R 260 KY+D +D+ + S NY++ + D +T + ++++ G + ++ Sbjct: 36 KYIDYDFGSDEKRQAAIQSGDYNYTMNYLLDTDQWGDKTFVIIMKFNGVPSSLNVITNKT 95 Query: 261 GNG 269 GNG Sbjct: 96 GNG 98 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.8 bits (44), Expect = 6.4 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = +3 Query: 117 IFELLHSEIINYSIEKFKNNDNGEK 191 +FE + ++++ S K +DNG++ Sbjct: 331 LFEFIRKQVLSGSTGKVAFDDNGDR 355 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,254 Number of Sequences: 438 Number of extensions: 3917 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -