BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0768 (663 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 28 0.23 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 24 3.7 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 28.3 bits (60), Expect = 0.23 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 552 PNIPHNFNASNYGGPNHYGNMPVNGPGS 635 PN+PHN N SN G N + GP S Sbjct: 175 PNMPHNVNYSNTGFNNSHMGGGGGGPNS 202 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +2 Query: 29 VVTLDLQTILQNSNWYKELSSTQKIFVNQHLVPV 130 VVTLD++ +++W S Q+I + ++L + Sbjct: 550 VVTLDVKNAFNSASWTAIARSLQRINIPKYLYDI 583 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 597,719 Number of Sequences: 2352 Number of extensions: 10540 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -