BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0765 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyce... 28 1.1 SPAC1783.03 |fta2|sma2|Sim4 and Mal2 associated |Schizosaccharom... 28 1.5 SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe... 27 3.4 >SPAC27E2.09 |mak2|phk1|histidine kinase Mak2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2310 Score = 28.3 bits (60), Expect = 1.1 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -2 Query: 370 KKIVVRFLQESMSLQNEYLLPLTI*SEVSHNNY 272 +K++ +F Q++ L+NEY L + S + NY Sbjct: 50 RKVIFKFSQQTFKLENEYFLLRQLSSHPNGRNY 82 >SPAC1783.03 |fta2|sma2|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 1|||Manual Length = 351 Score = 27.9 bits (59), Expect = 1.5 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -3 Query: 381 SKQ*KKSSCASYRSQCHYKMNTYYR--LLYEAR 289 SK KK + A+ +QC Y N++Y+ +LYE + Sbjct: 254 SKHMKKVASANMDAQCFYVQNSFYKITILYEIK 286 >SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 Query: 384 GGRAHSPPGVKWLLEPIDIYN 446 GG H P V WLL P DIY+ Sbjct: 235 GGPLHDPNTVMWLLRP-DIYS 254 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,715,643 Number of Sequences: 5004 Number of extensions: 54363 Number of successful extensions: 86 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -