BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0765 (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83109-6|CAB05522.1| 362|Caenorhabditis elegans Hypothetical pr... 29 2.4 AC006720-5|AAF60449.2| 297|Caenorhabditis elegans Hypothetical ... 28 5.6 >Z83109-6|CAB05522.1| 362|Caenorhabditis elegans Hypothetical protein F44G3.11 protein. Length = 362 Score = 29.5 bits (63), Expect = 2.4 Identities = 18/56 (32%), Positives = 24/56 (42%) Frame = -1 Query: 521 FEGWAAVVTILETLELISQGGWRIYVVDVYGFQ*PLNTRWAVSSSTHLSNKKNRRA 354 F+GW + I+ + G IY D RWA+ S L +KKN RA Sbjct: 136 FKGWRFIFCIMYCAAFGADWGLSIYYFDEMDAYADHYFRWALILSAALFHKKNSRA 191 >AC006720-5|AAF60449.2| 297|Caenorhabditis elegans Hypothetical protein Y17G9B.8 protein. Length = 297 Score = 28.3 bits (60), Expect = 5.6 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 306 SGSRYSFCSDIDSCRKRTTIFFIA*MGGRAHSPPGVKWLLEP 431 S SRY C D+D +K+ T+F R+H P KW P Sbjct: 175 SNSRYE-CRDVDDDKKKLTVF------ARSHLLPLPKWKANP 209 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,245,198 Number of Sequences: 27780 Number of extensions: 310251 Number of successful extensions: 507 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 507 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -