BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0762 (697 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57070.1 68416.m06354 glutaredoxin family protein contains Pf... 29 3.9 At3g26990.1 68416.m03377 expressed protein contains Pfam domain,... 28 6.8 >At3g57070.1 68416.m06354 glutaredoxin family protein contains Pfam profile PF00462: Glutaredoxin Length = 417 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/55 (34%), Positives = 26/55 (47%) Frame = -1 Query: 217 IVSHIKNALGARTLRRLHLSTPKRHREH*RLNRSPSSRPGPCTRDVTSHTGASEL 53 IVS K AL ++ L H +T HR L+ SPSS P + +S+L Sbjct: 201 IVSSYKKALSSKLLSN-HSNTRNPHRPTKSLSCSPSSNPSILISEEPKSVSSSQL 254 >At3g26990.1 68416.m03377 expressed protein contains Pfam domain, PF04818: Protein of unknown function, DUF618 Length = 513 Score = 27.9 bits (59), Expect = 6.8 Identities = 16/59 (27%), Positives = 31/59 (52%) Frame = -1 Query: 232 SSKLFIVSHIKNALGARTLRRLHLSTPKRHREH*RLNRSPSSRPGPCTRDVTSHTGASE 56 +S+ ++SH++ AL + L+ ++ R H ++ R S R G R + H G+S+ Sbjct: 235 TSRTSLISHLREALQEQELKL------EQVRNHLQIARFQSDRTGDLCRQLLDHGGSSQ 287 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,296,711 Number of Sequences: 28952 Number of extensions: 277372 Number of successful extensions: 559 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -