BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0761 (664 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK128541-1|BAC87490.1| 125|Homo sapiens protein ( Homo sapiens ... 31 4.9 >AK128541-1|BAC87490.1| 125|Homo sapiens protein ( Homo sapiens cDNA FLJ46700 fis, clone TRACH3013900. ). Length = 125 Score = 30.7 bits (66), Expect = 4.9 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 314 NWCFL*YYYLIHT*SRQIAVRIHPCFVVVNINCWC 210 +W FL +Y T SR + C++ +++ CWC Sbjct: 62 SWSFLKIFYYTLT-SRVHVHNVQDCYICIHVPCWC 95 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,620,219 Number of Sequences: 237096 Number of extensions: 1689556 Number of successful extensions: 2669 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2669 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7478817430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -