BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0761 (664 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022967-11|AAB69874.1| 192|Caenorhabditis elegans Hypothetical... 30 1.7 AF045642-1|AAZ82857.1| 230|Caenorhabditis elegans Hypothetical ... 29 3.9 >AF022967-11|AAB69874.1| 192|Caenorhabditis elegans Hypothetical protein C13A2.2 protein. Length = 192 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 45 NIRRKTLKLQWYSCYRSSIRSMAPIIIDTPNFILNC 152 NI RK++ ++Y C R I + A I P ++NC Sbjct: 100 NIDRKSVNCRYYDCNRQEISNSAFNTIVAPMAVINC 135 >AF045642-1|AAZ82857.1| 230|Caenorhabditis elegans Hypothetical protein C17H12.13 protein. Length = 230 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 29 RKCSFKHKKKNIEIAVVFLLSEFNKIYGSYYYRHTKLH 142 R C+++ +++ + AV FL FNK+ YY +L+ Sbjct: 97 RLCAYEFREQRVRDAVEFLKYVFNKLDVMYYLNEHRLY 134 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,563,780 Number of Sequences: 27780 Number of extensions: 294907 Number of successful extensions: 652 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 652 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -