BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0760 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP4H10.11c |||long-chain-fatty-acid-CoA ligase |Schizosaccharo... 25 7.9 SPAC26H5.02c |||DNA replication ATPase|Schizosaccharomyces pombe... 25 7.9 >SPBP4H10.11c |||long-chain-fatty-acid-CoA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 689 Score = 25.4 bits (53), Expect = 7.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 143 YTCIGHDGAYASFVECHLISKGHFTSP 223 Y +G DG Y S EC S+ FT P Sbjct: 156 YETLGEDGIYTSLDECK--SRAIFTDP 180 >SPAC26H5.02c |||DNA replication ATPase|Schizosaccharomyces pombe|chr 1|||Manual Length = 504 Score = 25.4 bits (53), Expect = 7.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 691 KKTFHDITMYLTHTHTQTCIYTVLVYRFHQS 599 +K F D YLT T +T I+ V+RF+++ Sbjct: 162 RKIFEDSQNYLTLTGRKTIIFLDEVHRFNRA 192 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,477,000 Number of Sequences: 5004 Number of extensions: 41956 Number of successful extensions: 80 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -