BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0760 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_35350| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) 31 0.68 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 2.7 SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) 29 2.7 SB_55690| Best HMM Match : AAA (HMM E-Value=0) 29 3.6 SB_16338| Best HMM Match : PHD (HMM E-Value=3.8e-08) 29 3.6 SB_4311| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) 29 4.8 SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 29 4.8 SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 29 4.8 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 29 4.8 SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 4.8 SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 29 4.8 SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 4.8 SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 29 4.8 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 29 4.8 SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) 29 4.8 SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 4.8 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 4.8 SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 4.8 SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 4.8 SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 4.8 SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) 29 4.8 SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 29 4.8 SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 4.8 SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 28 6.3 SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) 28 6.3 SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_1986| Best HMM Match : No HMM Matches (HMM E-Value=.) 23 6.8 SB_52991| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 28 8.4 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_9529| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) 28 8.4 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 33.1 bits (72), Expect = 0.22 Identities = 14/55 (25%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = -2 Query: 232 MICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXK-SFQVIQSRFCRIA 71 ++ +R+++ + + + Y TC+RP++ Y + + H + K + IQ R IA Sbjct: 625 VLLKRARVPVSDIIGFYNTCVRPILEYCAPLFHHTIPAYVKEDLEHIQKRALSIA 679 >SB_35350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 626 Score = 31.9 bits (69), Expect = 0.51 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -2 Query: 217 SKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCR 77 S + L+N KTCI P M+ + + V H R+H + + CR Sbjct: 507 SPVILKNPTVFKKTCILP-MSLSKIEVNHLVRLHVVEYHINVPHTCR 552 >SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) Length = 634 Score = 31.5 bits (68), Expect = 0.68 Identities = 11/36 (30%), Positives = 24/36 (66%) Frame = -2 Query: 253 EYXQXIPMICRRSKMSLRNKVTLYKTCIRPVMTYAS 146 ++ + +P++C +S +SL + +Y +C+R + YAS Sbjct: 470 KFRELLPILCSKS-LSLHTRGRIYSSCVRGALLYAS 504 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 223 RRSKMSLRNKVTLYKTCIRPVMTYASVVVXH 131 +R+ + ++ + Y TCIRPV YA V H Sbjct: 1213 KRANIKVKELLLFYLTCIRPVTEYACPVFHH 1243 >SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 403 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -2 Query: 223 RRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIH-XKSFQVIQSRFCRI 74 +RS ++ V+ ++TC+RP+ YA V + + S + +Q R RI Sbjct: 276 KRSGLAKSGLVSFFRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRALRI 326 >SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 370 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/61 (24%), Positives = 26/61 (42%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPWFV 50 + K+++ K+T+Y+ CI + Y S AR K R R +G W + Sbjct: 172 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHWRI 230 Query: 49 R 47 + Sbjct: 231 K 231 >SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) Length = 1130 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/41 (24%), Positives = 24/41 (58%) Frame = -2 Query: 232 MICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXK 110 ++ +R+ + + + + Y TC+RP++ Y + + HA + K Sbjct: 276 VLLKRTIVPVSDIIGFYDTCVRPILEYCAPLSYHAIPAYLK 316 >SB_55690| Best HMM Match : AAA (HMM E-Value=0) Length = 1031 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = -2 Query: 151 ASVVVXHAARIHXKSFQVIQSRFCRIAVGAPWFVRNVDLHDDLDLV 14 A VVV + + K + +Q + A W+ ++V L DDLD V Sbjct: 454 AHVVVVNCIHLRAKRVEAVQKHLQQAFTEAAWYQQSVLLLDDLDHV 499 >SB_16338| Best HMM Match : PHD (HMM E-Value=3.8e-08) Length = 652 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = -2 Query: 253 EYXQXIPMICRRSKMSLRNKVTLYKTCIRPVMTYA 149 ++ + +P++ +S +SLR + +Y +C+R M YA Sbjct: 545 KFKELLPVLSSKS-LSLRTRGKVYSSCVRSAMLYA 578 >SB_4311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/61 (22%), Positives = 28/61 (45%) Frame = -2 Query: 184 YKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPWFVRNVDLHDDLDLVSIS 5 + I+P+M Y V H + ++Q R RI W+ ++ L ++L++ + Sbjct: 3 FNALIQPLMDYCITVWGDNLIEHDNTILLLQKRAARIIAYKKWYDHSMALFEELNIEPFT 62 Query: 4 K 2 K Sbjct: 63 K 63 >SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) Length = 1283 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 688 KTFHDITMYLTHTHTQTCIYTVLVYRFHQSV 596 KTFH++T L+ + + YRFH SV Sbjct: 52 KTFHELTTILSGFYKPKVLEVAETYRFHHSV 82 >SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 226 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 8 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 64 >SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 558 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 614 >SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 223 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 8 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 64 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 520 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 576 >SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 89 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 145 >SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 88 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 144 >SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) Length = 661 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 469 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 525 >SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 89 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLHTFHMRCLRRILGIHW 145 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 8 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 64 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 309 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 365 >SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 92 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 8 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 64 >SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 226 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 8 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 64 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 2400 VWENKKLTISTKITVYRACILSTLLYGSEPWTTYAR-QEKRLNTFHMRCLRRILGIHW 2456 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 89 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLHTFHMRCLRRILGIHW 145 >SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 290 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 141 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 197 >SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 89 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 145 >SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 406 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 8 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 64 >SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) Length = 322 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 238 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 294 >SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 124 VWENKKLTISTKITVYRACILSTLLYGSKSWTTYAR-QEKRLNTFHMRCLRRILGIHW 180 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 198 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 254 >SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 348 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 141 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 197 >SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 223 RRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIH-XKSFQVIQSRFCRI 74 +R+ + Y TCIRP+M YA V ++ + + ++I+ R RI Sbjct: 331 KRASLGSEELHQFYLTCIRPIMEYACPVFHNSLPDYLSQDLEIIRRRALRI 381 >SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 8 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 64 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/58 (24%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ C+ + Y S AR K R R +G W Sbjct: 480 VWENKKLTISTKITVYRACVLSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 536 >SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 173 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/58 (25%), Positives = 24/58 (41%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 89 VWENKKLTISTKITVYRACILNTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 145 >SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -2 Query: 214 KMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIAVGAPW 56 K+++ K+T+Y+ CI + Y S AR K R R +G W Sbjct: 129 KLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLRRILGIHW 180 >SB_1986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 989 Score = 23.4 bits (48), Expect(2) = 6.8 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = +2 Query: 638 CLCVCVCQIH 667 C+CVCVC ++ Sbjct: 85 CVCVCVCGVY 94 Score = 23.0 bits (47), Expect(2) = 6.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 635 ACLCVCVC 658 AC CVCVC Sbjct: 82 ACTCVCVC 89 >SB_52991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 820 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +1 Query: 586 SI*PQIDEIDKLTQYKCMFVCVCVSNTW 669 SI P+IDE+D + + C+ + C++ +W Sbjct: 136 SILPKIDELDGVVAHNCVDI-ACITESW 162 >SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -2 Query: 193 VTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIA 71 +T+Y++ IR V+ YAS V + + + +Q R +IA Sbjct: 62 ITVYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSR-FCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R CRI +G W Sbjct: 312 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLCRI-LGIHW 368 >SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -2 Query: 223 RRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIH-XKSFQVIQSRFCRI 74 +RS + V+ ++TC+RP+ YA V + + S + +Q R RI Sbjct: 670 KRSGLGKSVLVSFFRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRGLRI 720 >SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSR-FCRIAVGAPW 56 + K+++ K+T+Y+ CI + Y S AR K R CRI +G W Sbjct: 192 VWENKKLTISTKITVYRACILSTLLYGSESWTTYAR-QEKRLNTFHMRCLCRI-LGIHW 248 >SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -2 Query: 193 VTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIA 71 +T+Y++ IR V+ YAS V + + + +Q R +IA Sbjct: 62 ITVYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = -2 Query: 223 RRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSR 86 ++ + + + VT+Y + IRP+ YASV+ + ++ + IQ R Sbjct: 4157 KKCGVPVEDMVTVYCSLIRPITEYASVIFSNIPCYLSEALEKIQRR 4202 >SB_9529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +1 Query: 586 SI*PQIDEIDKLTQYKCMFVCVCVSNTW 669 SI P+IDE+D + + C+ + C++ +W Sbjct: 136 SILPKIDELDGVVAHNCVDI-ACITESW 162 >SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) Length = 587 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/53 (22%), Positives = 27/53 (50%) Frame = -2 Query: 229 ICRRSKMSLRNKVTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCRIA 71 + ++ + + +T+Y++ IR V+ YAS + + + +Q R +IA Sbjct: 72 VLKKCGLDAKELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 124 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,683,810 Number of Sequences: 59808 Number of extensions: 325455 Number of successful extensions: 777 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 718 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 774 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -