BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0760 (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58738-4|AAB00604.1| 358|Caenorhabditis elegans Hypothetical pr... 32 0.34 AF043700-1|AAB97571.2| 328|Caenorhabditis elegans Hypothetical ... 31 0.79 >U58738-4|AAB00604.1| 358|Caenorhabditis elegans Hypothetical protein F31A9.6 protein. Length = 358 Score = 32.3 bits (70), Expect = 0.34 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Frame = -2 Query: 217 SKMSLRNK---VTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCR 77 +K S NK + LYKT IRP + Y +VV + K+ + +Q+ F R Sbjct: 210 NKYSTSNKKLMILLYKTFIRPRLEYGTVVSSPTKKSDEKTIESVQNAFTR 259 >AF043700-1|AAB97571.2| 328|Caenorhabditis elegans Hypothetical protein K09H9.4 protein. Length = 328 Score = 31.1 bits (67), Expect = 0.79 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = -2 Query: 193 VTLYKTCIRPVMTYASVVVXHAARIHXKSFQVIQSRFCR 77 + LYKT IRP + Y +VV + K+ + +Q+ F R Sbjct: 191 ILLYKTFIRPRLEYGTVVSSPTKKSDEKAIESVQNAFTR 229 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,817,491 Number of Sequences: 27780 Number of extensions: 245691 Number of successful extensions: 495 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 493 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -