BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0759 (696 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02590.1 68416.m00250 delta 7-sterol-C5-desaturase, putative ... 28 5.1 At1g22000.1 68414.m02752 F-box family protein contains F-box dom... 27 9.0 >At3g02590.1 68416.m00250 delta 7-sterol-C5-desaturase, putative similar to delta7 sterol C-5 desaturase GI:5031219 from [Arabidopsis thaliana] Length = 279 Score = 28.3 bits (60), Expect = 5.1 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -1 Query: 576 YFSCVLFYCCHSILMEFIFYWI 511 +F C L+ + +L+EF+ YW+ Sbjct: 126 WFLCFLYIALYLVLVEFMIYWV 147 >At1g22000.1 68414.m02752 F-box family protein contains F-box domain Pfam:PF00646 Length = 727 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/38 (39%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = -1 Query: 573 FSCVLFYCCHSI----LMEFIFYWITLIKLCKPLMAIL 472 FS + CC++I L+EF F+ I+L+ PLM +L Sbjct: 315 FSKSMVACCNAIKFSWLIEFYFFPISLVDWLMPLMFLL 352 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,199,358 Number of Sequences: 28952 Number of extensions: 212437 Number of successful extensions: 324 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 318 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 324 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -