BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0758 (685 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 27 0.11 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 27 0.11 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 2.3 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 7.1 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 27.5 bits (58), Expect = 0.11 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 90 FYRDVN*KRKSLSYRYKFSYYENNRKN 10 +Y++ N +K+ Y K YYENN N Sbjct: 418 YYQNENMLQKNAEYSGKVGYYENNHYN 444 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 27.5 bits (58), Expect = 0.11 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 Query: 90 FYRDVN*KRKSLSYRYKFSYYENNRKN 10 +Y++ N +K+ Y K YYENN N Sbjct: 366 YYQNENMLQKNAEYSGKVGYYENNHYN 392 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +1 Query: 118 VRGFLFALICD-YLGMSPKK 174 + GFLF LICD YL + K+ Sbjct: 13 IAGFLFLLICDSYLKIYHKE 32 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.4 bits (43), Expect = 7.1 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 353 TYA*MKLLKCISRKYH*IYKNTRNKNVFIN 264 T+A +++L + + YH N + +FIN Sbjct: 104 TFAGIEVLHVVKQCYHLQKINVQQSGIFIN 133 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,382 Number of Sequences: 336 Number of extensions: 2866 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17906060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -