BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0758 (685 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 24 5.1 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 9.0 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.8 bits (49), Expect = 5.1 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +3 Query: 156 RNESKKIIGYIYVRSLTDARDRTLTLNNGFSIHACGINENILVP 287 R + + Y R+ + +LT N F CG ++L+P Sbjct: 547 RRSDQSSVSIPYERTFRNVAASSLTQNEAFQFCNCGWPNHMLLP 590 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.0 bits (47), Expect = 9.0 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 427 RRIIIILN*FVCENLLDIDIRFD*KVPSHLPYDD 528 RR+I+IL V + LD DIR K ++L + D Sbjct: 1173 RRLIVILLGEVPQKDLDPDIRLYLKTNTYLQWGD 1206 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 600,224 Number of Sequences: 2352 Number of extensions: 10181 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -