BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0756 (689 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BX538286-1|CAD98081.1| 724|Homo sapiens hypothetical protein pr... 34 0.55 AL139421-4|CAI22511.1| 720|Homo sapiens coiled-coil domain cont... 31 2.9 AL139421-3|CAI22510.1| 1044|Homo sapiens coiled-coil domain cont... 31 2.9 AL139421-1|CAI22508.1| 1454|Homo sapiens coiled-coil domain cont... 31 2.9 AK126045-1|BAC86410.1| 978|Homo sapiens galactosaminyltransfera... 31 2.9 BC000246-1|AAH00246.2| 1393|Homo sapiens RNA polymerase II assoc... 31 5.1 AM083101-1|CAL07247.1| 101|Homo sapiens immunoglobulin heavy ch... 31 5.1 AB037824-1|BAA92641.1| 1337|Homo sapiens KIAA1403 protein protein. 31 5.1 U09825-1|AAA93131.1| 539|Homo sapiens acid finger protein protein. 30 6.8 BX248419-4|CAM26024.1| 248|Homo sapiens tripartite motif-contai... 30 6.8 BX248419-3|CAM26023.1| 539|Homo sapiens tripartite motif-contai... 30 6.8 BC032297-1|AAH32297.1| 539|Homo sapiens TRIM26 protein protein. 30 6.8 BC024039-1|AAH24039.1| 539|Homo sapiens tripartite motif-contai... 30 6.8 BA000025-86|BAB63330.1| 539|Homo sapiens ZNF173 protein. 30 6.8 AL845450-2|CAI17701.1| 539|Homo sapiens tripartite motif-contai... 30 6.8 AL844220-7|CAM25795.1| 248|Homo sapiens tripartite motif-contai... 30 6.8 AL844220-6|CAI18614.1| 539|Homo sapiens tripartite motif-contai... 30 6.8 AL671855-4|CAM25547.1| 248|Homo sapiens tripartite motif-contai... 30 6.8 AL671855-3|CAI18235.1| 539|Homo sapiens tripartite motif-contai... 30 6.8 AL662832-3|CAI17497.1| 539|Homo sapiens tripartite motif-contai... 30 6.8 AL662832-1|CAO72119.1| 248|Homo sapiens tripartite motif-contai... 30 6.8 AB202086-1|BAE78607.1| 539|Homo sapiens tripartite motif-contai... 30 6.8 AB103596-1|BAF31258.1| 539|Homo sapiens Zn-finger protein protein. 30 6.8 AB088090-1|BAC54923.1| 539|Homo sapiens tripartite motif-contai... 30 6.8 >BX538286-1|CAD98081.1| 724|Homo sapiens hypothetical protein protein. Length = 724 Score = 33.9 bits (74), Expect = 0.55 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = +2 Query: 227 EGAAPSVQELRTYILKEPAATFDLLQN--HNTSLDQMLQEDVSGKRKFKSTLTGEVNR 394 +G ++ELRT +++ A DL N H TS Q++QE++ K S L E+ + Sbjct: 239 QGLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTK 296 >AL139421-4|CAI22511.1| 720|Homo sapiens coiled-coil domain containing 18 protein. Length = 720 Score = 31.5 bits (68), Expect = 2.9 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +2 Query: 245 VQELRTYILKEPAATFDLLQN--HNTSLDQMLQEDVSGKRKFKSTLTGEVNR 394 ++ELRT +++ A DL N H TS Q++QE++ K S L E+ + Sbjct: 244 IEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTK 295 >AL139421-3|CAI22510.1| 1044|Homo sapiens coiled-coil domain containing 18 protein. Length = 1044 Score = 31.5 bits (68), Expect = 2.9 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +2 Query: 245 VQELRTYILKEPAATFDLLQN--HNTSLDQMLQEDVSGKRKFKSTLTGEVNR 394 ++ELRT +++ A DL N H TS Q++QE++ K S L E+ + Sbjct: 270 IEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTK 321 >AL139421-1|CAI22508.1| 1454|Homo sapiens coiled-coil domain containing 18 protein. Length = 1454 Score = 31.5 bits (68), Expect = 2.9 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +2 Query: 245 VQELRTYILKEPAATFDLLQN--HNTSLDQMLQEDVSGKRKFKSTLTGEVNR 394 ++ELRT +++ A DL N H TS Q++QE++ K S L E+ + Sbjct: 524 IEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTK 575 >AK126045-1|BAC86410.1| 978|Homo sapiens galactosaminyltransferase 9 protein. Length = 978 Score = 31.5 bits (68), Expect = 2.9 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +2 Query: 245 VQELRTYILKEPAATFDLLQN--HNTSLDQMLQEDVSGKRKFKSTLTGEVNR 394 ++ELRT +++ A DL N H TS Q++QE++ K S L E+ + Sbjct: 204 IEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTK 255 >BC000246-1|AAH00246.2| 1393|Homo sapiens RNA polymerase II associated protein 1 protein. Length = 1393 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -1 Query: 284 QPVPSVCRSSV---LVLTELLPRTWXILQVLQPGPA 186 +P P + R V L+ T LLPR +L+V PGPA Sbjct: 525 RPPPDLARHDVIKGLLATSLLPRLRYVLEVTYPGPA 560 >AM083101-1|CAL07247.1| 101|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 101 Score = 30.7 bits (66), Expect = 5.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 172 WVSFWAGPGCKTCKIXQVRGSSSVST 249 WVS +G GC TC V+G ++ST Sbjct: 50 WVSAISGSGCTTCYADSVKGRFTIST 75 >AB037824-1|BAA92641.1| 1337|Homo sapiens KIAA1403 protein protein. Length = 1337 Score = 30.7 bits (66), Expect = 5.1 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -1 Query: 284 QPVPSVCRSSV---LVLTELLPRTWXILQVLQPGPA 186 +P P + R V L+ T LLPR +L+V PGPA Sbjct: 547 RPPPDLARHDVIKGLLATSLLPRLRYVLEVTYPGPA 582 >U09825-1|AAA93131.1| 539|Homo sapiens acid finger protein protein. Length = 539 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >BX248419-4|CAM26024.1| 248|Homo sapiens tripartite motif-containing 26 protein. Length = 248 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >BX248419-3|CAM26023.1| 539|Homo sapiens tripartite motif-containing 26 protein. Length = 539 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >BC032297-1|AAH32297.1| 539|Homo sapiens TRIM26 protein protein. Length = 539 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >BC024039-1|AAH24039.1| 539|Homo sapiens tripartite motif-containing 26 protein. Length = 539 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >BA000025-86|BAB63330.1| 539|Homo sapiens ZNF173 protein. Length = 539 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >AL845450-2|CAI17701.1| 539|Homo sapiens tripartite motif-containing 26 protein. Length = 539 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >AL844220-7|CAM25795.1| 248|Homo sapiens tripartite motif-containing 26 protein. Length = 248 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >AL844220-6|CAI18614.1| 539|Homo sapiens tripartite motif-containing 26 protein. Length = 539 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >AL671855-4|CAM25547.1| 248|Homo sapiens tripartite motif-containing 26 protein. Length = 248 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >AL671855-3|CAI18235.1| 539|Homo sapiens tripartite motif-containing 26 protein. Length = 539 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >AL662832-3|CAI17497.1| 539|Homo sapiens tripartite motif-containing 26 protein. Length = 539 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >AL662832-1|CAO72119.1| 248|Homo sapiens tripartite motif-containing 26 protein. Length = 248 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >AB202086-1|BAE78607.1| 539|Homo sapiens tripartite motif-containing 26 protein. Length = 539 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >AB103596-1|BAF31258.1| 539|Homo sapiens Zn-finger protein protein. Length = 539 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 >AB088090-1|BAC54923.1| 539|Homo sapiens tripartite motif-containing 26 protein. Length = 539 Score = 30.3 bits (65), Expect = 6.8 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 233 AAPSVQELRTYILKEPAATFDLLQNHNTSLDQML----QEDVSGKRKFKSTLTGEVNRVS 400 A +Q+ R YI+ E L+ L + L QE G+ KFKS GE+ R++ Sbjct: 177 ALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLA 236 Query: 401 AVLAD 415 V+++ Sbjct: 237 LVISE 241 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,809,890 Number of Sequences: 237096 Number of extensions: 2441829 Number of successful extensions: 6546 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 6112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6534 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7895240574 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -