BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0754 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 26 1.3 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 3.0 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 5.3 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 9.2 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 9.2 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 25.8 bits (54), Expect = 1.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -3 Query: 471 DGEWLPSPIDLSNARGRARPLPTANSWFEYTEIWV 367 DGEW P ID +G +P N Y +WV Sbjct: 255 DGEWEPPMIDNPEYKGEWKPKQIDNP--AYKGVWV 287 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 24.6 bits (51), Expect = 3.0 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 440 RSMGDGNHSPSGG-PYARLPTRAIKPRNPSGNMSSVSA 550 RS + ++SP GG P P + PR P G + S+ Sbjct: 1095 RSETEPDNSPMGGSPRPETPAFPVTPRTPYGLSNGTSS 1132 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 5.3 Identities = 9/27 (33%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = -1 Query: 137 FKYYFV---CWLNILMIQYVCFNFLGT 66 FK YF CWL+ +++ NF+ + Sbjct: 1363 FKVYFTNAWCWLDFIIVMVSLINFVAS 1389 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 486 LVCLQGQ*NLATHQETCRQ 542 + CLQ Q LA + TC+Q Sbjct: 241 VACLQNQKKLACKKSTCQQ 259 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 486 LVCLQGQ*NLATHQETCRQ 542 + CLQ Q LA + TC+Q Sbjct: 241 VACLQNQKKLACKKSTCQQ 259 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 721,228 Number of Sequences: 2352 Number of extensions: 15517 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -