BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0752 (673 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18.04 |pof6||F-box protein Pof6|Schizosaccharomyces pombe|ch... 26 5.7 SPAC13C5.07 |rad32|mre11|Rad32 nuclease|Schizosaccharomyces pomb... 25 7.5 >SPCC18.04 |pof6||F-box protein Pof6|Schizosaccharomyces pombe|chr 3|||Manual Length = 872 Score = 25.8 bits (54), Expect = 5.7 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = +2 Query: 374 ANLSFL*AWR*FYPLYRYVIKYGDTVDELLYFHF 475 A L ++ WR P+YR + +T+D + + F Sbjct: 168 ARLDYIKVWRALAPIYRNLAYASNTIDPIAFSAF 201 >SPAC13C5.07 |rad32|mre11|Rad32 nuclease|Schizosaccharomyces pombe|chr 1|||Manual Length = 649 Score = 25.4 bits (53), Expect = 7.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 651 LINYFGSIVYHNNIVVFSTLSQ 586 L+NYFG + ++NIVV L Q Sbjct: 154 LVNYFGRVPENDNIVVSPILLQ 175 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,340,501 Number of Sequences: 5004 Number of extensions: 43517 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 307866294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -