BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0748 (673 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like pepti... 24 3.8 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 6.6 >AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like peptide 2 precursor protein. Length = 134 Score = 24.2 bits (50), Expect = 3.8 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 240 CGXSLTGSLPSVXPGX*PQXXHHRPDXARQASXQ 341 CG LT +L + G P H+R D + Q Sbjct: 47 CGRRLTETLAFLCQGRYPMLTHYRTDYVHDQANQ 80 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.4 bits (48), Expect = 6.6 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 192 SAAPSSVWRPXPTVIRCGXSLTGSLPSVXP 281 SA S + RP PTV+ + SL V P Sbjct: 66 SAVSSQLQRPQPTVLAASPAPQPSLAPVVP 95 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 653,968 Number of Sequences: 2352 Number of extensions: 12405 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -