BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0744 (696 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) 40 0.003 SB_8130| Best HMM Match : RVT_1 (HMM E-Value=8e-35) 38 0.010 SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) 36 0.031 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 36 0.041 SB_47293| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4e-06) 35 0.072 SB_55887| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.096 SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) 34 0.096 SB_43639| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.096 SB_40565| Best HMM Match : DUF1274 (HMM E-Value=6.2) 34 0.096 SB_54945| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.13 SB_52811| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) 34 0.13 SB_46852| Best HMM Match : AT_hook (HMM E-Value=2.6) 34 0.13 SB_45857| Best HMM Match : DUF1274 (HMM E-Value=2.4) 34 0.13 SB_43890| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_38360| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_37313| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_36818| Best HMM Match : RVT_1 (HMM E-Value=8e-35) 34 0.13 SB_36139| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_32772| Best HMM Match : AT_hook (HMM E-Value=2.6) 34 0.13 SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_23180| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_21043| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_16201| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_13125| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_8476| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_4898| Best HMM Match : CaMBD (HMM E-Value=1.2) 34 0.13 SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.13 SB_59259| Best HMM Match : AT_hook (HMM E-Value=2.6) 34 0.13 SB_58038| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_46411| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_45064| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.13 SB_36149| Best HMM Match : AT_hook (HMM E-Value=2.6) 34 0.13 SB_30735| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.13 SB_24790| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_22656| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_12973| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_11676| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_11315| Best HMM Match : AT_hook (HMM E-Value=2.6) 34 0.13 SB_10586| Best HMM Match : RVT_1 (HMM E-Value=0.039) 34 0.13 SB_9839| Best HMM Match : AT_hook (HMM E-Value=3.3) 34 0.13 SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46) 34 0.13 SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36) 34 0.13 SB_10620| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) 33 0.17 SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_4403| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.17 SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58) 33 0.22 SB_21106| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_42325| Best HMM Match : RVT_1 (HMM E-Value=0.52) 33 0.22 SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58) 33 0.22 SB_23124| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.22 SB_23084| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.22 SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065) 33 0.22 SB_2120| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.22 SB_1327| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.22 SB_56412| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.29 SB_50753| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) 33 0.29 SB_31784| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 32 0.39 SB_9680| Best HMM Match : Ank (HMM E-Value=4e-20) 32 0.39 SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.39 SB_46530| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.67 SB_42583| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_27880| Best HMM Match : Activin_recp (HMM E-Value=5.1) 31 1.2 SB_56116| Best HMM Match : zf-C2H2 (HMM E-Value=0.022) 31 1.2 SB_28328| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_27259| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_21608| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_6922| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 30 1.6 SB_24663| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) 29 2.7 SB_22340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_33808| Best HMM Match : Fibrinogen_C (HMM E-Value=0) 29 3.6 SB_33679| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_32967| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_1928| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_42747| Best HMM Match : Sugar_tr (HMM E-Value=0.23) 28 6.3 SB_39654| Best HMM Match : PMG (HMM E-Value=2.1) 28 6.3 SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_24913| Best HMM Match : RVT_1 (HMM E-Value=1e-20) 28 6.3 SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37) 28 6.3 SB_16378| Best HMM Match : DCX (HMM E-Value=0.7) 28 6.3 SB_14294| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_6135| Best HMM Match : CSD (HMM E-Value=5.4) 28 6.3 SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) 28 8.3 SB_28600| Best HMM Match : EGF_CA (HMM E-Value=4.2e-40) 28 8.3 >SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) Length = 492 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/63 (31%), Positives = 32/63 (50%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVERFRERGDLRR 497 ++I NE + K PV + + R W GH +R+ + ++ LT N + R+RG R Sbjct: 387 DKISNEELWQRTKQQPVDQDVLQRRWRWIGHTLRKPATNITRQSLTWNPQGKRKRG-RPR 445 Query: 496 NGW 488 N W Sbjct: 446 NTW 448 >SB_8130| Best HMM Match : RVT_1 (HMM E-Value=8e-35) Length = 869 Score = 37.5 bits (83), Expect = 0.010 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNV-ERFRERG 509 +RI N V + K+ A+L WYGHV+R E+ + ++VL + +R++G Sbjct: 756 DRITNLEVLDRADTTSIEAKILQAQLRWYGHVIRMEESRIPRQVLYSELASGYRKKG 812 >SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) Length = 1641 Score = 35.9 bits (79), Expect = 0.031 Identities = 19/63 (30%), Positives = 31/63 (49%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVERFRERGDLRR 497 ++I NE + K PV + + R W GH + + + ++ LT N + R+RG R Sbjct: 142 DKISNEELWQRTKQQPVDQDVLHRRWRWIGHTLPKPATNITRQSLTWNPKGKRKRG-RPR 200 Query: 496 NGW 488 N W Sbjct: 201 NTW 203 Score = 35.9 bits (79), Expect = 0.031 Identities = 19/63 (30%), Positives = 31/63 (49%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVERFRERGDLRR 497 ++I NE + K PV + + R W GH + + + ++ LT N + R+RG R Sbjct: 502 DKISNEELWQRTKQQPVDQDVLHRRWRWIGHTLPKPATNITRQSLTWNPKGKRKRG-RPR 560 Query: 496 NGW 488 N W Sbjct: 561 NTW 563 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 35.5 bits (78), Expect = 0.041 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W+GH+ R +++ V K++L +E Sbjct: 721 ISNEDVLRRANVDDIETKLARNRLRWFGHLCRMDDDRVPKQLLFSELE 768 >SB_47293| Best HMM Match : Exo_endo_phos (HMM E-Value=1.4e-06) Length = 744 Score = 34.7 bits (76), Expect = 0.072 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -3 Query: 682 EWN-RIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 +W+ I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 619 KWDDHISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 671 >SB_55887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 34.3 bits (75), Expect = 0.096 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVER 524 I NE V V + KL RL W GH+ R +++ V K++L +E+ Sbjct: 174 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELEQ 222 >SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) Length = 634 Score = 34.3 bits (75), Expect = 0.096 Identities = 20/61 (32%), Positives = 28/61 (45%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVERFRERGDLRR 497 N I +R L + + LR RL WYGHV R ++ + +E R RG R+ Sbjct: 535 NDISTSELRLRLNIEDLDAALRRRRLRWYGHVQR--STSWIRWIRDFIIEGKRTRGRPRK 592 Query: 496 N 494 N Sbjct: 593 N 593 >SB_43639| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 34.3 bits (75), Expect = 0.096 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 129 ISNEDVLRRANVEDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 176 >SB_40565| Best HMM Match : DUF1274 (HMM E-Value=6.2) Length = 294 Score = 34.3 bits (75), Expect = 0.096 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVER 524 I NE V V + KL RL W GH+ R +++ V K++L +E+ Sbjct: 174 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELEQ 222 >SB_54945| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 392 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 286 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 333 >SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 559 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 510 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 557 >SB_52811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 34 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 81 >SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) Length = 1074 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 954 ISNEDVLRCANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 1001 >SB_46852| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 174 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 221 >SB_45857| Best HMM Match : DUF1274 (HMM E-Value=2.4) Length = 288 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 174 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 221 >SB_43890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 83 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 130 >SB_38360| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 387 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 267 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 314 >SB_37313| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 83 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 130 >SB_36818| Best HMM Match : RVT_1 (HMM E-Value=8e-35) Length = 629 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNV-ERFRERG 509 +RI N V + K+ A+L W GHV+R E+ + ++VL + +R++G Sbjct: 477 DRITNLEVLDRADTTSIEAKILQAQLRWSGHVIRMEESRIPRQVLYSELASGYRKKG 533 >SB_36139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 315 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 362 >SB_32772| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 255 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 135 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 182 >SB_32387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 912 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 794 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 841 >SB_23180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/56 (28%), Positives = 28/56 (50%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVERFRERG 509 ++I NE + K PV + + R W GH + + + ++ LT N + R+RG Sbjct: 168 DKISNEELWQRTKQQPVDQDVLHRRWRWIGHTLPKPATNITRQSLTWNPKGKRKRG 223 >SB_21043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 122 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 169 >SB_16201| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 154 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 34 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 81 >SB_13125| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 154 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 34 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 81 >SB_8476| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 202 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 129 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 176 >SB_4898| Best HMM Match : CaMBD (HMM E-Value=1.2) Length = 259 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNV-ERFRERG 509 +RI N V + K+ A+L W GHV+R E+ + ++VL + +R++G Sbjct: 198 DRITNLEVLDRADTTSIEAKILQAQLRWSGHVIRMEESRIPRQVLYSELASGYRKKG 254 >SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 591 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 433 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 480 >SB_59259| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 203 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 83 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 130 >SB_58038| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 201 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 81 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 128 >SB_50300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3669 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNV-ERFRERG 509 +RI N V + K+ A+L W GHV+R E+ + ++VL + +R++G Sbjct: 3247 DRITNLEVLDRADTTSIEAKILQAQLRWSGHVIRMEESRIPRQVLYSELASGYRKKG 3303 >SB_46411| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 146 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 26 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 73 >SB_45064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 73 ISNEDVLHRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 120 >SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 675 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 555 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 602 >SB_36149| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 174 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 221 >SB_30735| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 129 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 176 >SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 636 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 516 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 563 >SB_24790| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 226 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 106 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 153 >SB_22656| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 129 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 176 >SB_12973| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 129 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 176 >SB_11676| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 146 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 26 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 73 >SB_11315| Best HMM Match : AT_hook (HMM E-Value=2.6) Length = 294 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 174 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 221 >SB_10586| Best HMM Match : RVT_1 (HMM E-Value=0.039) Length = 590 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 470 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 517 >SB_9839| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 127 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 7 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 54 >SB_8297| Best HMM Match : RVT_1 (HMM E-Value=0.46) Length = 404 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 284 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 331 >SB_962| Best HMM Match : RVT_1 (HMM E-Value=2.5e-36) Length = 1195 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNV-ERFRERG 509 +RI N V + K+ A+L W GHV+R E+ + ++VL + +R++G Sbjct: 1017 DRITNLEVLDRADTTSIEAKILQAQLRWSGHVIRMEESRIPRQVLYSELASGYRKKG 1073 >SB_10620| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) Length = 159 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -3 Query: 673 RIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNV-ERFRERG 509 RI N V + K+ A+L W GHV+R E+ + ++VL + +R++G Sbjct: 8 RITNLEVLDRADTTSIEAKILQAQLRWSGHVIRMEESRIPRQVLYSELASGYRKKG 63 >SB_57033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 686 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNV-ERFRERG 509 +RI N V+ + K+ A+L W GHV+R E+ + ++V + +R++G Sbjct: 482 DRITNLEVQDRADTTSIEAKILQAQLRWSGHVIRMEESRIPRQVFYSELASGYRKKG 538 >SB_6793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 135 ISNEDVLCRANVDDIETKLARNRLRWLGHLCRMDDDRVPKQLLFSELE 182 >SB_4403| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R ++ V K++L +E Sbjct: 174 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDDGRVPKQLLFSELE 221 >SB_49557| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 404 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH R +++ V K++L +E Sbjct: 284 ISNEDVLRRANVDDIETKLARNRLRWLGHFCRMDDDRVPKQLLFSELE 331 >SB_21106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R +++ V K++L +E Sbjct: 83 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRVDDDRVPKQLLFSELE 130 >SB_42325| Best HMM Match : RVT_1 (HMM E-Value=0.52) Length = 333 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH R +++ V K++L +E Sbjct: 284 ISNEDVLRRANVDDIETKLARNRLRWLGHFCRMDDDRVPKQLLFSELE 331 >SB_26530| Best HMM Match : RVT_1 (HMM E-Value=0.58) Length = 359 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH R +++ V K++L +E Sbjct: 284 ISNEDVLRRANVDDIETKLARNRLRWLGHFCRMDDDRVPKQLLFSELE 331 >SB_23124| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH R +++ V K++L +E Sbjct: 83 ISNEDVLRRANVDDIETKLARNRLRWLGHFCRMDDDRVPKQLLFSELE 130 >SB_23084| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH R +++ V K++L +E Sbjct: 129 ISNEDVLRRANVDDIETKLARNRLRWLGHFCRMDDDRVPKQLLFSELE 176 >SB_16102| Best HMM Match : RVT_1 (HMM E-Value=0.00065) Length = 435 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH R +++ V K++L +E Sbjct: 315 ISNEDVLRRANVDDIETKLARNRLRWLGHFCRMDDDRVPKQLLFSELE 362 >SB_2120| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 235 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH R +++ V K++L +E Sbjct: 161 ISNEDVLRRANVDDIETKLARNRLRWLGHFCRMDDDRVPKQLLFSELE 208 >SB_1327| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 203 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH R +++ V K++L +E Sbjct: 83 ISNEDVLRRANVDDIETKLARNRLRWLGHFCRMDDDRVPKQLLFSELE 130 >SB_56412| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 249 Score = 32.7 bits (71), Expect = 0.29 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVE 527 I NE V V + KL RL W GH+ R + + V K++L +E Sbjct: 129 ISNEDVLRRANVDDIETKLARNRLRWLGHLCRMDADRVPKQLLFSELE 176 >SB_50753| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) Length = 401 Score = 32.7 bits (71), Expect = 0.29 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNV-ERFRERG 509 +RI N V + K+ A+L W GHV+R E+ + ++V ++ +R++G Sbjct: 253 DRITNLEVLDRADTTSIEAKILQAQLRWSGHVIRMEESRIPRQVFYSDLASGYRKKG 309 >SB_31784| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 963 Score = 32.3 bits (70), Expect = 0.39 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNV-ERFRERG 509 +RI N V + K+ A+L W GHV+R E+ + ++V + +R++G Sbjct: 811 DRITNLEVLDRADTTSIEAKILQAQLRWSGHVIRMEESRIPRQVFYSELASGYRKKG 867 >SB_9680| Best HMM Match : Ank (HMM E-Value=4e-20) Length = 1243 Score = 32.3 bits (70), Expect = 0.39 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 541 LTLS*QPHFHSVSSHVHTIPNVHSSASLSQVP 636 L + QPH H+V H+H +P+VH+ + VP Sbjct: 858 LVIGKQPHVHAVP-HIHGVPDVHAVPHIHAVP 888 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 532 HS*LTLS*QPHFHSVSSHVHTIPNVHSSASLSQVP 636 H+ L + PH H+V H+H +P++H + VP Sbjct: 927 HAVLDIHALPHIHAVP-HIHAVPHIHGMLDIHAVP 960 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 559 PHFHSVSSHVHTIPNVHSSASLSQVPLSDFL*RIHS 666 PH H V VH +P++H+ + VP + IH+ Sbjct: 870 PHIHGVPD-VHAVPHIHAVPDVHAVPYIHAILDIHA 904 >SB_6541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 32.3 bits (70), Expect = 0.39 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNV-ERFRERG 509 +RI N V + K+ A+L W GHV+R E+ + ++V + +R++G Sbjct: 649 DRITNLEVLDRADTTSIEAKILQAQLRWSGHVIRMEESRIPRQVFYRELASGYRKKG 705 >SB_46530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.5 bits (68), Expect = 0.67 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVK 551 N I NE + + + + ++R RL W GHV+R ++ + K Sbjct: 22 NVISNEELYKNTSSSSLVNQIRYRRLKWLGHVLRMDQQRIPK 63 >SB_42583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVERFRERGDLRR 497 +RI N V + K A+L W GHV+R E+ + ++V ER E R Sbjct: 7 DRITNLEVLDRADTTSIEAKKLQAQLRWSGHVIRMEESRIPRQVFYS--ERQLEAAASNR 64 Query: 496 NGW 488 W Sbjct: 65 TCW 67 >SB_27880| Best HMM Match : Activin_recp (HMM E-Value=5.1) Length = 415 Score = 30.7 bits (66), Expect = 1.2 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 3/100 (3%) Frame = +3 Query: 405 TCFLLPYSSIIYHFFAHSPPTHIVFHTIHPF--LLRSPLSLNLSTFIVNTLLTTSFSFR- 575 TC P +S+ + + PT + H HP+ L SL++S + N + Sbjct: 170 TCLYTPRTSLQVSVYTKNIPTRVCIHQEHPYTCLYTPKTSLHVSVYTKNIPTRVCIHQKH 229 Query: 576 LITCPYHPKRALLSFSVTGATFRLPLTDSFRILFHSRYSH 695 TC Y PK L V+ T +P R+ H ++S+ Sbjct: 230 PYTCLYTPKTFL---HVSVYTKNIPT----RVCIHRKHSY 262 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 3/72 (4%) Frame = +3 Query: 405 TCFLLPYSSIIYHFFAHSPPTHIVFHTIHPFL-LRSPLS-LNLSTFIVNTLLTTSFSFR- 575 TC P +S+ + + PT + H HP+ L +P + L++S + N + Sbjct: 108 TCLYTPKTSLHVSVYTKNIPTRVCIHQKHPYTRLYTPRTFLHVSVYTKNISTRVCIHQKH 167 Query: 576 LITCPYHPKRAL 611 TC Y P+ +L Sbjct: 168 PYTCLYTPRTSL 179 >SB_56116| Best HMM Match : zf-C2H2 (HMM E-Value=0.022) Length = 129 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/63 (30%), Positives = 27/63 (42%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVERFRERGDLRR 497 +RI N V + K A+L W GHV+R E+ + ++V ER E R Sbjct: 7 DRITNLEVLDRADTTSIEAKKLQAQLRWSGHVIRMEESRIPRQVFYS--ERQLEAAASNR 64 Query: 496 NGW 488 W Sbjct: 65 TCW 67 >SB_28328| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRV 545 +RI N V + K+ A+L W GHV+R E+ + +++ Sbjct: 7 DRITNLEVLDRADTTSIEAKILQAQLRWSGHVIRMEESRIPRQL 50 >SB_27259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVK 551 N I N+ + + + + ++R RL W GHV+R ++ + K Sbjct: 22 NVISNQELYKNTSSSSLVNQIRYRRLKWLGHVLRMDQQRIPK 63 >SB_21608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -3 Query: 673 RIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVK 551 +I NE + +T++++ RL W GHV+R + + K Sbjct: 23 KISNEDLYCKTGSYNITQEIKRRRLKWLGHVLRMGQERIPK 63 >SB_6922| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) Length = 425 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMN 533 +RI N V + V +R A+ W GHV R +++ + T+N Sbjct: 378 DRITNTEVLERANLPSVITTMRKAQTRWAGHVCRMSDSRIPNSCCTVN 425 >SB_24663| Best HMM Match : Exo_endo_phos (HMM E-Value=6.7e-05) Length = 666 Score = 29.5 bits (63), Expect = 2.7 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -3 Query: 628 VTEKLRSARLGWYGHVMRRNENEVVK 551 +T++++ RL W GHV+R + + K Sbjct: 577 ITQEIKRCRLKWLGHVLRMGQERIPK 602 >SB_22340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 249 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = -3 Query: 670 IRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVL 542 I N+ + + V ++++ R+ W GHV+R ++ + K L Sbjct: 24 ISNQELYKKTRSHSVVDEIKCRRMRWLGHVLRMDQRRIPKVAL 66 >SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 625 TEKLRSARLGWYGHVMRRNENEVVKRVL 542 ++KLR RL W GHV R + K +L Sbjct: 145 SDKLRITRLRWLGHVCRMENGRIPKDLL 172 >SB_33808| Best HMM Match : Fibrinogen_C (HMM E-Value=0) Length = 280 Score = 29.1 bits (62), Expect = 3.6 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = -3 Query: 628 VTEKLRSARLGWYGHVMRRNENEVVK 551 +T++++ RL W GHV+R + + K Sbjct: 191 ITQEIKRRRLKWLGHVLRMGQERIPK 216 >SB_33679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = -3 Query: 658 SVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVLTMNVERFRERGDLRR 497 ++R L + + LR ARL W+GHV R V + R +G R+ Sbjct: 32 TIRDRLGIESLELALRKARLQWFGHVERAQAPNPVSSIRDFEPGGRRMKGRPRK 85 >SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1925 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 341 VSTSQHHHHYPALLPVTWGRRNMFSPSILFYHIPFLRSLPSYP 469 V T+ HHH + G N S + +IPF + P YP Sbjct: 1527 VITNNTHHHQNQSFTLERGSTNSKESSFINMNIPFQQISPKYP 1569 >SB_32967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = -3 Query: 679 WNRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVL 542 ++ I + V + + L+ A+L W GHV R ++ + K++L Sbjct: 268 YDHIPDTEVLDRANMFSINTMLQQAQLRWAGHVRRMSDTRIPKQLL 313 >SB_1928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVL 542 N I NE + + V ++R RL W GHV+ ++ + K L Sbjct: 45 NVISNEELYKKTGSSSVINQVRYQRLKWLGHVLLMDQQRIPKIAL 89 >SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = -3 Query: 679 WNRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVL 542 ++ I + V + + L+ A+L W GHV R ++ + K++L Sbjct: 419 YDHIPDTEVLDRANMFSINTMLQQAQLRWAGHVRRMSDTRIPKQLL 464 >SB_42747| Best HMM Match : Sugar_tr (HMM E-Value=0.23) Length = 527 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +2 Query: 569 IPSHHMSIPSQTCTPQLLCHRCHFQTSSNGFIPDSIPFSLL 691 IP +H + + TC P CH C F + ++L+ Sbjct: 60 IPEYHCADSNTTCLPSECCHNCTSYAYDGPFFSTASEWNLI 100 >SB_39654| Best HMM Match : PMG (HMM E-Value=2.1) Length = 393 Score = 28.3 bits (60), Expect = 6.3 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 4/34 (11%) Frame = +3 Query: 603 RALLSFSVTGATFRLP----LTDSFRILFHSRYS 692 RAL SF V G+ FR+P + SFR+L+ SRY+ Sbjct: 83 RALGSFRVLGS-FRVPGSFRVLGSFRVLYRSRYA 115 >SB_38222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 356 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -3 Query: 673 RIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVL 542 +I SV + + L+ A+L W GHV R ++ + K++L Sbjct: 202 KILGISVLDRANMFSINTMLQQAQLRWAGHVRRMSDTRIPKQLL 245 >SB_24913| Best HMM Match : RVT_1 (HMM E-Value=1e-20) Length = 906 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = -3 Query: 679 WNRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVL 542 ++ I + V + + L+ A+L W GHV R ++ + K++L Sbjct: 719 YDHIPDTEVLDRANMFSINTMLQQAQLRWAGHVRRMSDTRIPKQLL 764 >SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37) Length = 565 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = -3 Query: 679 WNRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVL 542 ++ I + V + + L+ A+L W GHV R ++ + K++L Sbjct: 414 YDHIPDTEVLDRANMFSINTMLQQAQLRWAGHVRRMSDTRIPKQLL 459 >SB_16378| Best HMM Match : DCX (HMM E-Value=0.7) Length = 754 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = -3 Query: 679 WNRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVL 542 ++ I + V + + L+ A+L W GHV R ++ + K++L Sbjct: 214 YDHIPDTEVLDRANMFSINTMLQQAQLRWAGHVRRMSDTRIPKQLL 259 >SB_14294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +3 Query: 435 IYHFFAHSPPTHIVFHTIHPFLLRSPLSLNLSTFIVNTL 551 +++ A+S TH++ T HPF+ L L L F+++ + Sbjct: 12 LFNVTANSTDTHVLGQTPHPFIRIVKLLLYLIIFLISAI 50 >SB_6135| Best HMM Match : CSD (HMM E-Value=5.4) Length = 254 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = -3 Query: 679 WNRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRNENEVVKRVL 542 ++ I + V + + L+ A+L W GHV R ++ + K++L Sbjct: 109 YDHIPDTEVLDRANMFSINTMLQQAQLRWAGHVRRMSDTRIPKQLL 154 >SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 370 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 619 KLRSARLGWYGHVMRRNENEVVKRVL 542 KLR RL W GHV R + K +L Sbjct: 231 KLRITRLRWLGHVCRMENGRIPKDLL 256 >SB_28600| Best HMM Match : EGF_CA (HMM E-Value=4.2e-40) Length = 1042 Score = 27.9 bits (59), Expect = 8.3 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 5/64 (7%) Frame = -3 Query: 676 NRIRNESVRGSLKVAPVTEKLRSARLGWYGHVMRRN-----ENEVVKRVLTMNVERFRER 512 +RI N V + K+ A+L W GHV+R N R LT N + E Sbjct: 282 DRITNLEVLDRADTTSIEAKILQAQLRWSGHVIRMELEAAASNRTCWRALTSNAVQSFE- 340 Query: 511 GDLR 500 GD R Sbjct: 341 GDRR 344 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,894,924 Number of Sequences: 59808 Number of extensions: 359745 Number of successful extensions: 1130 Number of sequences better than 10.0: 92 Number of HSP's better than 10.0 without gapping: 967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -