BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0744 (696 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 6.4 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 8.5 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 6.4 Identities = 12/49 (24%), Positives = 27/49 (55%) Frame = -3 Query: 610 SARLGWYGHVMRRNENEVVKRVLTMNVERFRERGDLRRNGWIV*KTIWV 464 ++R+ M+ + ++ K +L+ + R +ERG++ G + KT W+ Sbjct: 548 ASRMEATSQAMQIHISQSTKELLSPSY-RVKERGEIEVKGKGIMKTYWL 595 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 8.5 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = +2 Query: 341 VSTSQHHHHYPALLPVTWGRRNMFSPSILFYHIPFLRSLPSYPYR 475 VS + +H P ++ ++ R + FS + H+ FLR++P Y ++ Sbjct: 114 VSYTSGFYHIP-VIGIS-SRDSAFSDKNI--HVSFLRTVPPYSHQ 154 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,429 Number of Sequences: 438 Number of extensions: 3610 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -