BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0744 (696 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g26030.1 68416.m03242 serine/threonine protein phosphatase 2A... 30 1.3 At3g11380.1 68416.m01384 pentatricopeptide (PPR) repeat-containi... 30 1.3 At3g09880.1 68416.m01178 serine/threonine protein phosphatase 2A... 29 3.9 At3g26020.1 68416.m03241 serine/threonine protein phosphatase 2A... 28 5.1 At1g13460.2 68414.m01575 serine/threonine protein phosphatase 2A... 28 5.1 At1g13460.1 68414.m01574 serine/threonine protein phosphatase 2A... 28 5.1 At4g30110.1 68417.m04281 ATPase E1-E2 type family protein / halo... 27 9.0 At4g15415.2 68417.m02357 serine/threonine protein phosphatase 2A... 27 9.0 At4g15415.1 68417.m02356 serine/threonine protein phosphatase 2A... 27 9.0 >At3g26030.1 68416.m03242 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 477 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 4 HEVFFFFFLTQPFISRNLNNILVNFIHTHFNH 99 H ++ F + +PFI + +NNIL +FI H Sbjct: 222 HRIYGRFMVHRPFIRKTMNNILYDFIFETGKH 253 >At3g11380.1 68416.m01384 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 541 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/58 (27%), Positives = 29/58 (50%) Frame = -3 Query: 562 EVVKRVLTMNVERFRERGDLRRNGWIV*KTIWVGGE*AKKWYMIEEYGRRKHVAPTPG 389 E R+ M V +RE+G + + +V KT+W+ G ++EE ++ + PG Sbjct: 323 EFDNRIPDMLVSGYREKGMVMKADKLVNKTLWIRGLATPITLLLEEMDKKGNKVSPPG 380 >At3g09880.1 68416.m01178 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B' (B'beta) identical to B' regulatory subunit of PP2A [Arabidopsis thaliana] GI:2160692; similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 499 Score = 28.7 bits (61), Expect = 3.9 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 4 HEVFFFFFLTQPFISRNLNNILVNFIHTHFNH 99 H ++ F + +PFI + +NNI FI+ H Sbjct: 233 HRIYGKFMVHRPFIRKAINNIFYRFIYETERH 264 >At3g26020.1 68416.m03241 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 510 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 4 HEVFFFFFLTQPFISRNLNNILVNFIHTHFNH 99 H ++ F + +PFI +++NNI F+ H Sbjct: 255 HRIYGKFMVHRPFIRKSINNIFYRFVFETEKH 286 >At1g13460.2 68414.m01575 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 492 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 4 HEVFFFFFLTQPFISRNLNNILVNFIHTHFNH 99 H ++ F + +PFI +++NNI F+ H Sbjct: 234 HRIYGKFMVHRPFIRKSINNIFYRFVFETEKH 265 >At1g13460.1 68414.m01574 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 492 Score = 28.3 bits (60), Expect = 5.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 4 HEVFFFFFLTQPFISRNLNNILVNFIHTHFNH 99 H ++ F + +PFI +++NNI F+ H Sbjct: 234 HRIYGKFMVHRPFIRKSINNIFYRFVFETEKH 265 >At4g30110.1 68417.m04281 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein / heavy-metal-associated domain-containing protein similar to cadmium efflux pump protein from Geobacillus stearothermophilus [GI:16753175], cadmium resistance protein B from Staphylococcus aureus [GI:14020985] Length = 951 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -2 Query: 473 DMGRRGVSEEMVYDRRVWKEKTCCADPR*LGEGQDN 366 D G E D +K+CCA+P LG G D+ Sbjct: 762 DHSHSGCCETKQKDNVTVVKKSCCAEPVDLGHGHDS 797 >At4g15415.2 68417.m02357 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B' (B'gamma) identical to B' regulatory subunit of PP2A [Arabidopsis thaliana] GI:2160694; similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 522 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 4 HEVFFFFFLTQPFISRNLNNILVNFIHTHFNH 99 H ++ F + +PFI + +NNI FI H Sbjct: 243 HRIYGKFMVHRPFIRKAINNIFYRFIFETEKH 274 >At4g15415.1 68417.m02356 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B' (B'gamma) identical to B' regulatory subunit of PP2A [Arabidopsis thaliana] GI:2160694; similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 522 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 4 HEVFFFFFLTQPFISRNLNNILVNFIHTHFNH 99 H ++ F + +PFI + +NNI FI H Sbjct: 243 HRIYGKFMVHRPFIRKAINNIFYRFIFETEKH 274 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,273,854 Number of Sequences: 28952 Number of extensions: 254564 Number of successful extensions: 678 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -