BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0739 (601 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC337.12 |||human ZC3H3 homolog|Schizosaccharomyces pombe|chr ... 26 3.7 SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces po... 25 6.4 >SPBC337.12 |||human ZC3H3 homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 377 Score = 26.2 bits (55), Expect = 3.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 370 CSKYNFIGNCMSPQCKRY 423 C+ Y G+C +PQC Y Sbjct: 314 CTDYAMFGSCNNPQCSLY 331 >SPAC2F3.10 |||GARP complex subunit Vps54 |Schizosaccharomyces pombe|chr 1|||Manual Length = 949 Score = 25.4 bits (53), Expect = 6.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 224 SDHEHI*NLIKKAIFIYRVLKY*VKMDCVAI*P 322 S H +I +L K I +Y+VL + DCV + P Sbjct: 853 SPHGYIIDLSKSLIKLYKVLHRYSQRDCVEVIP 885 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,408,491 Number of Sequences: 5004 Number of extensions: 47685 Number of successful extensions: 81 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -