Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0739
         (601 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g20550.1 68415.m02400 DNAJ chaperone C-terminal domain-contai...    27   9.5  

>At2g20550.1 68415.m02400 DNAJ chaperone C-terminal
           domain-containing protein contains Pfam profile PF01556:
           DnaJ C terminal region; similar to DnaJ-like proteins
           (GI:6179940) [Nicotiana tabacum] and(GI:11863723)
           [Lycopersicon esculentum]; similar to DnaJ homolog
           subfamily B member 1 (Heat shock 40 kDa protein 1) (Heat
           shock protein 40) (HSP40) (DnaJ protein homolog 1)
           (HDJ-1) (Swiss-Prot:P25685) [Homo sapiens] and
           (Swiss-Prot:Q9QYJ3) [Mus musculus]
          Length = 284

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
 Frame = -3

Query: 152 EDEAHSSFPRSLMSRLVSPEYTVI*NFTNYTINVTP-SWRGLESPPNS 12
           +++ H  F R     +V+ + +V+  FT YT+N+T    R L  P N+
Sbjct: 185 DEKPHPVFTREGNDLVVTQKISVLEAFTGYTVNLTTLDGRRLTIPVNT 232


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,604,582
Number of Sequences: 28952
Number of extensions: 254743
Number of successful extensions: 462
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 452
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 461
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1187288784
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)