BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0738 (551 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54606| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.47 SB_51024| Best HMM Match : 7tm_1 (HMM E-Value=5.8e-08) 28 4.4 >SB_54606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 31.5 bits (68), Expect = 0.47 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 297 LRTYISRCVAHLLCRCLCAPV 359 LR + RC+ LCRCLCA V Sbjct: 9 LRQRLCRCLCRCLCRCLCADV 29 >SB_51024| Best HMM Match : 7tm_1 (HMM E-Value=5.8e-08) Length = 342 Score = 28.3 bits (60), Expect = 4.4 Identities = 16/55 (29%), Positives = 31/55 (56%) Frame = -2 Query: 304 VLRSQVQLQRLFRPSNRTHYCFTAEIGRVVVPTRLDSQVVLPQVNVIIMSITIIE 140 V+ S +Q R+ R S T + E+ +V+ T L Q ++P V++ +MS +++ Sbjct: 133 VMASCLQEIRIRRRSIHTTLLLSDELTKVLRITSLIIQYIIPAVSLTVMSFRVLK 187 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,055,659 Number of Sequences: 59808 Number of extensions: 310676 Number of successful extensions: 524 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 524 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -