BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0733 (696 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G9.14 |sak1||transcriptional repressor Sak1|Schizosaccharom... 26 5.9 SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccha... 25 7.8 >SPAC3G9.14 |sak1||transcriptional repressor Sak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 766 Score = 25.8 bits (54), Expect = 5.9 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -1 Query: 456 LATTLSTHVSSVFKSISTCSSMYTKQKLTNVVSKMIKVILK 334 LA L H+SS++ S S+C + K + + S ++ +L+ Sbjct: 478 LAENLVNHISSIYASHSSC-LLQVKSETAAIFSNLLSRLLR 517 >SPAC1093.06c |dhc1|SPAC30C2.01c|dynein heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 4196 Score = 25.4 bits (53), Expect = 7.8 Identities = 13/53 (24%), Positives = 22/53 (41%) Frame = +2 Query: 236 FFSKMAAYKKKVNCVYTVLKVLCT*IYIXNNDYFKITFIILLTTLVNFCFVYI 394 F S +Y N +++ + + N FK + L L+ CF+YI Sbjct: 3732 FISLKKSYSFSFNFIWSTFHQMLNVVLENRNQDFKSLIMDALRDLIRRCFLYI 3784 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,717,254 Number of Sequences: 5004 Number of extensions: 53579 Number of successful extensions: 138 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -