BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0733 (696 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 23 2.1 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 23 2.1 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 23 2.8 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 23 2.8 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 117 PAKRTPPLAFPTVPNLHGPAIFEF 188 PA RTP + P + +HG A F+F Sbjct: 113 PADRTPSQSLPVIFWIHGGA-FQF 135 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 117 PAKRTPPLAFPTVPNLHGPAIFEF 188 PA RTP + P + +HG A F+F Sbjct: 113 PADRTPSQSLPVIFWIHGGA-FQF 135 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/46 (19%), Positives = 24/46 (52%) Frame = -1 Query: 285 VYTQLTFFL*AAIFEKKQYRGYVRFGNLLQKNKIQKWPAHVNSEPL 148 +YT+ + ++ +++ + + L NK+Q+W +N +P+ Sbjct: 67 IYTEESVSALSSFYDRTKMSLQLVLAALYPPNKLQQWNEDLNWQPI 112 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/46 (19%), Positives = 24/46 (52%) Frame = -1 Query: 285 VYTQLTFFL*AAIFEKKQYRGYVRFGNLLQKNKIQKWPAHVNSEPL 148 +YT+ + ++ +++ + + L NK+Q+W +N +P+ Sbjct: 82 IYTEESVSALSSFYDRTKMSLQLVLAALYPPNKLQQWNEDLNWQPI 127 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,271 Number of Sequences: 438 Number of extensions: 4079 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -