BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0732 (574 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q54I48 Cluster: Putative uncharacterized protein; n=1; ... 33 4.8 UniRef50_Q6MNK5 Cluster: COG2356 Endonuclease I precursor; n=2; ... 33 6.3 >UniRef50_Q54I48 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 628 Score = 33.1 bits (72), Expect = 4.8 Identities = 17/37 (45%), Positives = 26/37 (70%) Frame = +2 Query: 206 NTV*SQNLLI*QESVLRFKHVIFLILVHLCNIFILFL 316 NT+ SQ L++ ++++L K VIF+IL +C IF L L Sbjct: 264 NTIPSQRLVMQEKNILALK-VIFIILCVVCGIFALIL 299 >UniRef50_Q6MNK5 Cluster: COG2356 Endonuclease I precursor; n=2; Bdellovibrio bacteriovorus|Rep: COG2356 Endonuclease I precursor - Bdellovibrio bacteriovorus Length = 297 Score = 32.7 bits (71), Expect = 6.3 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +2 Query: 29 PGAIXNTT*IRAQHTLTKSFWTRRFTKKKQK 121 PG+I N T I +HT +S +TRRF QK Sbjct: 141 PGSIPNNTVINVEHTWPQSHFTRRFPDDVQK 171 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 497,951,544 Number of Sequences: 1657284 Number of extensions: 8461893 Number of successful extensions: 17592 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17589 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 39154548218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -