Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0731
         (728 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0)                      42   5e-04

>SB_4344| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 1080

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 28/71 (39%), Positives = 31/71 (43%), Gaps = 1/71 (1%)
 Frame = +3

Query: 3   DHPTKAKGVSGLIEVENPNRVVXXXXXXXXXXXXGDVEKP-QLSXXXXXXXXXXXXXXXY 179
           D   K  GV  LIE+ENPNRV+             D   P QLS               Y
Sbjct: 132 DEEAKPTGVQALIEIENPNRVL---QKTKKVTEIDDAPAPAQLSRREKEEIAKQQAKLRY 188

Query: 180 QKLHAEGKTEQ 212
           QKL AEGKT+Q
Sbjct: 189 QKLQAEGKTDQ 199


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,778,485
Number of Sequences: 59808
Number of extensions: 232444
Number of successful extensions: 390
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 329
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 389
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1949964354
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)