BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0731 (728 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92782-3|CAB07189.2| 326|Caenorhabditis elegans Hypothetical pr... 29 4.5 >Z92782-3|CAB07189.2| 326|Caenorhabditis elegans Hypothetical protein F14F8.4 protein. Length = 326 Score = 28.7 bits (61), Expect = 4.5 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 4/86 (4%) Frame = +3 Query: 468 FYCIYRSLVITFNLA----NQILSYLFFVLVISYT*LLNKKYISKYLTIYSWS*LNVHKT 635 FY I ++++T+ LA N IL F V++ L + KY+ + ++YS + ++HK Sbjct: 91 FYLITVAILLTYLLAGLYINYILQQTFHVILFLLAILNSLKYLFPFNSVYSQN--SIHKY 148 Query: 636 A**FFVSSLIAYFVYLRIMGKYFYCF 713 F V+ ++ ++ + +F CF Sbjct: 149 VRHFSVAIVLKDVLFFSPLLVHF-CF 173 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,278,202 Number of Sequences: 27780 Number of extensions: 197287 Number of successful extensions: 399 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 399 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -