BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0730 (704 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5K944 Cluster: RAD protein; n=1; Plasmodium vivax|Rep:... 34 3.9 UniRef50_Q4GYE9 Cluster: Putative uncharacterized protein; n=1; ... 33 9.0 UniRef50_Q23BX5 Cluster: Putative uncharacterized protein; n=1; ... 33 9.0 >UniRef50_A5K944 Cluster: RAD protein; n=1; Plasmodium vivax|Rep: RAD protein - Plasmodium vivax Length = 307 Score = 33.9 bits (74), Expect = 3.9 Identities = 28/107 (26%), Positives = 54/107 (50%), Gaps = 5/107 (4%) Frame = +2 Query: 167 TRVKTKHLH--LDDLRTELNELNTTKYCASEEKRKLWAKSS*YLTGVA*VGLTETKLFF- 337 +R++T +D+L +ELN+L++ + EEK+KLW + ++ L E ++ Sbjct: 179 SRIQTSDFQRVMDNLSSELNKLSSKYGMSEEEKKKLWNECQEEIS----KDLKEVDDYYD 234 Query: 338 -FVDCSMRK*HFAKELLSISSVDALSR-MDSWQSGRGHHFGWWCAFF 472 F D +M+ A + + S V +++ ++ W + WCAFF Sbjct: 235 KFYDINMQ----ADSVATASFVSSITNFLNMWTNSIDKTEKKWCAFF 277 >UniRef50_Q4GYE9 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 101 Score = 32.7 bits (71), Expect = 9.0 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -1 Query: 680 CITSMLINIRCADTP*VIRDSFLIYYYYYLVSTFF 576 CIT ++ +RC DT ++ S L+Y+YYY F Sbjct: 11 CIT-VICALRCIDTAPILSYSILLYHYYYFCMCVF 44 >UniRef50_Q23BX5 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1154 Score = 32.7 bits (71), Expect = 9.0 Identities = 18/47 (38%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = -1 Query: 314 IQLKPLRSSINWISPTISFSLHWHNILSY-LVHLVLFLDHLSVNALF 177 I +K L++S N+ SP + H + I S+ L+HL +FL ++NA F Sbjct: 216 IHIKQLKNSFNFTSP-LCTKTHAYYITSFILLHLYIFLPSANLNATF 261 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 619,486,203 Number of Sequences: 1657284 Number of extensions: 10864802 Number of successful extensions: 21626 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21589 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56198352344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -