BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0730 (704 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11H11.04 |mam2||pheromone p-factor receptor|Schizosaccharomy... 27 3.5 SPAPB21F2.02 |||Dopey family protein|Schizosaccharomyces pombe|c... 26 6.0 >SPAC11H11.04 |mam2||pheromone p-factor receptor|Schizosaccharomyces pombe|chr 1|||Manual Length = 348 Score = 26.6 bits (56), Expect = 3.5 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = -2 Query: 184 LCFNSSSLICGY*QCSSFLIMYIHYYTYVYLMRSP 80 +C NS S++ Y + + MY+H + + L+ +P Sbjct: 101 ICSNSYSILVNYGFILNMVHMYVHVFNILILLLAP 135 >SPAPB21F2.02 |||Dopey family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1687 Score = 25.8 bits (54), Expect = 6.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 195 KCKCFVLTLVL*YADISSAHHSS*CTSITIL 103 KCKC +L+L+ Y S HH S+ ++ Sbjct: 531 KCKCSLLSLLKQYIKDSHVHHEVLLISLNLI 561 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,659,090 Number of Sequences: 5004 Number of extensions: 49865 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -