SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0729
         (700 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.      23   2.1  
AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic ac...    21   8.5  

>EF589162-1|ABQ84439.1|  686|Apis mellifera hexamerin 70c protein.
          Length = 686

 Score = 23.4 bits (48), Expect = 2.1
 Identities = 12/50 (24%), Positives = 25/50 (50%)
 Frame = -2

Query: 156 FILSYKYTQKNIYTYNFILHKYIHTFIHAHINIIVYTVLKGIYYYILSLQ 7
           +I++  Y+ KN+  YN   +K  +      +N   Y + + + Y++ S Q
Sbjct: 200 YIVNTNYSSKNMREYNDPEYKLDYFMEDVELNAYYYYMREMLPYWMSSSQ 249


>AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha-3 protein.
          Length = 537

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -3

Query: 650 PSMRKSDYYYCC 615
           P+ R  +YY CC
Sbjct: 221 PASRNEEYYPCC 232


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 175,115
Number of Sequences: 438
Number of extensions: 3719
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21439440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -