BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= prgv0729
(700 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 2.1
AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 8.5
>EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein.
Length = 686
Score = 23.4 bits (48), Expect = 2.1
Identities = 12/50 (24%), Positives = 25/50 (50%)
Frame = -2
Query: 156 FILSYKYTQKNIYTYNFILHKYIHTFIHAHINIIVYTVLKGIYYYILSLQ 7
+I++ Y+ KN+ YN +K + +N Y + + + Y++ S Q
Sbjct: 200 YIVNTNYSSKNMREYNDPEYKLDYFMEDVELNAYYYYMREMLPYWMSSSQ 249
>AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic
acetylcholine receptoralpha-3 protein.
Length = 537
Score = 21.4 bits (43), Expect = 8.5
Identities = 6/12 (50%), Positives = 8/12 (66%)
Frame = -3
Query: 650 PSMRKSDYYYCC 615
P+ R +YY CC
Sbjct: 221 PASRNEEYYPCC 232
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 175,115
Number of Sequences: 438
Number of extensions: 3719
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21439440
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -