BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0721 (686 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC026115-1|AAH26115.1| 307|Homo sapiens hypothetical LOC339541 ... 31 3.8 AY254217-1|AAP80384.1| 370|Homo sapiens p40 protein. 31 3.8 >BC026115-1|AAH26115.1| 307|Homo sapiens hypothetical LOC339541 protein. Length = 307 Score = 31.1 bits (67), Expect = 3.8 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -3 Query: 591 DSCLAHLLRAIKFYINTVNNRRSTVIYRNSGQTFNLLTII 472 DSCL LLR+I +++ V++ R + + G LL I+ Sbjct: 73 DSCLEKLLRSIGIFLSAVSSNRYLIEFLEVGGVLTLLEIL 112 >AY254217-1|AAP80384.1| 370|Homo sapiens p40 protein. Length = 370 Score = 31.1 bits (67), Expect = 3.8 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -3 Query: 591 DSCLAHLLRAIKFYINTVNNRRSTVIYRNSGQTFNLLTII 472 DSCL LLR+I +++ V++ R + + G LL I+ Sbjct: 3 DSCLEKLLRSIGIFLSAVSSNRYLIEFLEVGGVLTLLEIL 42 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,586,504 Number of Sequences: 237096 Number of extensions: 1960425 Number of successful extensions: 2691 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2691 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7839245960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -