Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0721
         (686 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g39240.1 68417.m05555 kelch repeat-containing F-box family pr...    30   1.7  

>At4g39240.1 68417.m05555 kelch repeat-containing F-box family
           protein similar to SKP1 interacting partner 6
           [Arabidopsis thaliana] GI:10716957; contains Pfam
           profiles PF01344: Kelch motif, PF00646: F-box domain
          Length = 375

 Score = 29.9 bits (64), Expect = 1.7
 Identities = 16/43 (37%), Positives = 22/43 (51%)
 Frame = +3

Query: 12  SCYLNNKILTISVAYRFGEWGNRNIGILWDRRPKVDLMVDKRD 140
           SC ++ KI T     R   W    I ++WDR   +D + DKRD
Sbjct: 269 SCVIDGKIYTFGSKNRI--WVFDPIAMVWDRLKGLDDLPDKRD 309


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,385,773
Number of Sequences: 28952
Number of extensions: 283621
Number of successful extensions: 557
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 546
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 557
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1457719448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)