BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0720 (713 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 32 0.021 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 31 0.047 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 30 0.083 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 29 0.19 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 29 0.19 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 28 0.33 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 25 1.8 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 25 1.8 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 25 1.8 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 25 1.8 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 25 2.4 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 25 3.1 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 4.1 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 24 4.1 EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 7.2 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 9.5 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 9.5 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 31.9 bits (69), Expect = 0.021 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 584 LSQYPSAEVVVLGDFNAHHQEW 519 L + +VVV GDFNA H+EW Sbjct: 121 LEGFSHPQVVVAGDFNARHEEW 142 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 30.7 bits (66), Expect = 0.047 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 563 EVVVLGDFNAHHQEWLGSK 507 +VVV GDFNA H+EW GS+ Sbjct: 174 QVVVAGDFNAWHEEW-GSR 191 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 29.9 bits (64), Expect = 0.083 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 566 AEVVVLGDFNAHHQEW 519 + VVV GDFNA H+EW Sbjct: 179 SRVVVAGDFNAWHEEW 194 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 28.7 bits (61), Expect = 0.19 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -1 Query: 566 AEVVVLGDFNAHHQEWLGSK 507 + VV+ GDFNA H EW GS+ Sbjct: 116 SHVVIAGDFNAWHTEW-GSR 134 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 28.7 bits (61), Expect = 0.19 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 566 AEVVVLGDFNAHHQEW 519 ++VV+ GDFNA H EW Sbjct: 117 SQVVIAGDFNAWHVEW 132 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 27.9 bits (59), Expect = 0.33 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 566 AEVVVLGDFNAHHQEW 519 ++VV+ GDFNA H EW Sbjct: 136 SQVVIDGDFNAWHTEW 151 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 253 PPNLLTNTAKLFDTWSSFDD 312 PP + +T K+ TW FDD Sbjct: 123 PPGIFKSTCKIDITWFPFDD 142 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 253 PPNLLTNTAKLFDTWSSFDD 312 PP + +T K+ TW FDD Sbjct: 140 PPGIFKSTCKIDITWFPFDD 159 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 253 PPNLLTNTAKLFDTWSSFDD 312 PP + +T K+ TW FDD Sbjct: 140 PPGIFKSTCKIDITWFPFDD 159 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 25.4 bits (53), Expect = 1.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 253 PPNLLTNTAKLFDTWSSFDD 312 PP + +T K+ TW FDD Sbjct: 155 PPGIFKSTCKIDITWFPFDD 174 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 25.0 bits (52), Expect = 2.4 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -1 Query: 584 LSQYPSAEVVVLGDFNAHHQEW 519 +S +P+ VV+ GDFNA H+ W Sbjct: 110 VSAHPN--VVLGGDFNAWHEAW 129 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 575 YPSAEVVVLGDFNAHHQEWLGSK 507 Y +++ GDFNA EW GSK Sbjct: 110 YDVNPIIISGDFNAWATEW-GSK 131 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 24.2 bits (50), Expect = 4.1 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = -1 Query: 602 RGLTACLSQY-----PSAEVVVLGDFNAHHQEWLGSKPLTS 495 R L C+S + PS + V+GDFN W + P +S Sbjct: 202 RSLHDCISSFTLRLKPSDLLFVIGDFNQPSISWSTADPSSS 242 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 24.2 bits (50), Expect = 4.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 560 VVVLGDFNAHHQEWLGSKPLTS 495 +V+ GDFNA EW GSK S Sbjct: 113 LVIAGDFNAWAVEW-GSKRTNS 133 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -1 Query: 212 AXPLLILTSVRTXLKTWCSRGWNCLSPPL 126 A PL ++ + T WC +GW P+ Sbjct: 420 AGPLGVVFAAFTASYFWCGQGWELEDNPV 448 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 369 GASTTTLYPAGSVVSRRSNREGS 437 GA TT YPA + R + +GS Sbjct: 958 GAGTTNGYPAHEPLKRSNTMDGS 980 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 396 AGSVVSRRSNREGSCPSISGTRVGCVT 476 AGS NRE PSI + G T Sbjct: 1149 AGSPAELSGNRERRSPSIPNSNAGAAT 1175 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 798,002 Number of Sequences: 2352 Number of extensions: 17917 Number of successful extensions: 42 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -