BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0719 (697 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 24 1.4 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 23 2.4 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 23 2.4 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 22 4.2 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 7.3 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +3 Query: 570 FPCRPYSLXCGICLPCF-CSPRNAGESKRC 656 F PY++ G+CL F P N S++C Sbjct: 191 FTYMPYNIVFGLCLTTFGLLPVNGVTSEKC 220 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -3 Query: 518 GLLFMSGYIFECI*KNKQIGVPRTFPRKVPPDAPCSGALSA 396 G G I E + KN+ G+P F V P G++++ Sbjct: 306 GYTTREGMIVEMMRKNETPGMPNDFEEFVHPTVAKRGSITS 346 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 23.0 bits (47), Expect = 2.4 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -3 Query: 518 GLLFMSGYIFECI*KNKQIGVPRTFPRKVPPDAPCSGALSA 396 G G I E + KN+ G+P F V P G++++ Sbjct: 306 GYTTREGMIVEMMRKNETPGMPNDFEEFVHPTVAKRGSITS 346 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 22.2 bits (45), Expect = 4.2 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -3 Query: 518 GLLFMSGYIFECI*KNKQIGVPRTFPRKVPPDAPCSGALSA 396 G G I E + KN+ G+P F V P G++++ Sbjct: 304 GYTTREGMIVEMMRKNETPGMPNDFEGFVHPTVAKRGSITS 344 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.4 bits (43), Expect = 7.3 Identities = 7/25 (28%), Positives = 12/25 (48%) Frame = +3 Query: 138 TWTPTSKGEKPSIRAMAHYVNHHPN 212 TW G + ++ M +VN P+ Sbjct: 271 TWNVVFNGSRKNLDVMKSFVNFRPS 295 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,710 Number of Sequences: 336 Number of extensions: 2924 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -