BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0719 (697 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1586 - 34621945-34623366 28 6.2 03_05_1149 + 30753463-30754695,30754834-30755017,30755321-307565... 28 6.2 >04_04_1586 - 34621945-34623366 Length = 473 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 173 YQGDGPLREPSP*SSFLGSRCRKALNRTLKG 265 Y PL +P+ SSF G C A+ RTL G Sbjct: 165 YAQTDPLFDPAASSSFSGVSCGSAICRTLSG 195 >03_05_1149 + 30753463-30754695,30754834-30755017,30755321-30756549, 30756702-30756816,30757126-30758084 Length = 1239 Score = 28.3 bits (60), Expect = 6.2 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 5/41 (12%) Frame = -1 Query: 652 LLLSPAFLGEQKXGRQ-----MPQXRE*GRHGKC*ILILFL 545 LLL PA L E K G Q MP+ R GRH +C +FL Sbjct: 833 LLLVPAMLEESKEGIQRWQLTMPECRYAGRHMECEDTHMFL 873 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,915,276 Number of Sequences: 37544 Number of extensions: 323317 Number of successful extensions: 682 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -