BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0719 (697 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 7.0 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 23 9.2 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 7.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 536 LLKHLSGLLFMSGYIFECI*KNKQIGVPRTFPRKVPPD 423 L+ + G+ +G F+C+ KNK T P ++ PD Sbjct: 1446 LIFAIMGVQLFAGKYFKCVDKNK-----TTLPHEIIPD 1478 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 23.0 bits (47), Expect = 9.2 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 257 GSDLVLYGTSTPKNLIRVMVHVVGHRPDRRF 165 G DLVL G PK ++ M +V R + F Sbjct: 397 GKDLVLQGYRVPKGILVGMGQLVLQREEGYF 427 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,051 Number of Sequences: 2352 Number of extensions: 12766 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -