BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0714 (676 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8660| Best HMM Match : Carboxyl_trans (HMM E-Value=0) 31 1.1 SB_44648| Best HMM Match : UPF0005 (HMM E-Value=0.00022) 29 2.6 >SB_8660| Best HMM Match : Carboxyl_trans (HMM E-Value=0) Length = 1311 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 553 YIFVFSMIICNFGKRLNLNLTCLKLHDLRGP 461 ++F FS++ C+ +RL L + K H L GP Sbjct: 1075 WLFEFSIVYCSSSRRLPLKFSTKKTHALSGP 1105 >SB_44648| Best HMM Match : UPF0005 (HMM E-Value=0.00022) Length = 192 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = -1 Query: 214 TSMPGFIMV-IVLRICFFFVRIIFYNFLIRNLFGLL 110 T M GF+ V +++ ICF F+ I F+N +++ ++ L Sbjct: 100 TMMGGFLFVALIVLICFGFLAIFFHNRVVQIVYASL 135 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,244,291 Number of Sequences: 59808 Number of extensions: 300152 Number of successful extensions: 482 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -