BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0714 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.7 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 23 2.7 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 22 4.7 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 6.1 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 8.1 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 154 IIFYNFLIRNLFGLLHFTRIIFVISI 77 +I Y F I +G+LH T +I +++ Sbjct: 241 MIVYEFSISRHYGILHATYVIPAVTM 266 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 23.0 bits (47), Expect = 2.7 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +2 Query: 461 WTPQIMQFQACQVQIKSFP 517 WTP + +C++ ++ FP Sbjct: 135 WTPPAIFKSSCEIDVRYFP 153 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 244 ITYIHCICFITSMPGFIMVIVLRICFFFVRI 152 + +I C P + V+ L IC FF+ I Sbjct: 69 VIWIFCAAKSLRTPSNMFVVNLAICDFFMMI 99 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 277 DVTYFKFKFRTMLITYRTFLF 339 DVTYF F +T ++ + ++ F Sbjct: 154 DVTYFPFDQQTCIMKFGSWTF 174 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 8.1 Identities = 9/35 (25%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = +2 Query: 422 VTI*FSLTINF---YFWTPQIMQFQACQVQIKSFP 517 VT+ T+N+ W P + +C++ ++ FP Sbjct: 123 VTLATKATLNYTGRVEWKPPAIYKSSCEIDVEYFP 157 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,224 Number of Sequences: 438 Number of extensions: 3302 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -