BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0714 (676 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g27850.1 68417.m03999 proline-rich family protein contains pr... 31 0.70 At5g66020.1 68418.m08313 phosphoinositide phosphatase family pro... 28 6.6 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 31.1 bits (67), Expect = 0.70 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +3 Query: 549 IYFPTYAFMPYFNIIFKKKTLTTWAYIRPNFNKILCRV*T 668 I+FP+ ++ F+++F WA I P FN ++ + T Sbjct: 298 IHFPSIKYLSVFSLLFLAILTLPWASISPIFNNLIAAIKT 337 >At5g66020.1 68418.m08313 phosphoinositide phosphatase family protein contains similarity to phosphoinositide phosphatase SAC1 [Rattus norvegicus] gi|11095248|gb|AAG29810; contains Pfam domain, PF02383: SacI homology domain; non-consensus AT donor splice site at exon 7, TA donor splice site at exon 10, AT acceptor splice at exon 13 Length = 549 Score = 27.9 bits (59), Expect = 6.6 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = -1 Query: 520 FGKRLNLNLTCLKLHDLRGPKVKING**KSNRYYFNWRNHVNCNTLTEQWLNYFLICV 347 F +NL LT +LHDL G + K+ + F W N++ L + L+ FL+ V Sbjct: 139 FSYEINLTLTAQRLHDL-GDESKLLPLWRQAEPRFLWNNYM-LEVLIDNKLDQFLLPV 194 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,299,358 Number of Sequences: 28952 Number of extensions: 223761 Number of successful extensions: 365 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 365 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -