BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0712 (682 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe... 26 4.4 SPAPB8E5.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 5.8 >SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 26.2 bits (55), Expect = 4.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 664 GGRAHXPAGVKWLLEPIDIYN 602 GG H P V WLL P DIY+ Sbjct: 235 GGPLHDPNTVMWLLRP-DIYS 254 >SPAPB8E5.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 103 Score = 25.8 bits (54), Expect = 5.8 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +1 Query: 157 KTVKYKNTAGMLRCTIDNTLLYKIYTYIINKYFTYSYISNTFFFNY 294 K + KN + N + IY YI +F YS++ + + F Y Sbjct: 56 KKSRRKNQRNSSSIGLSNPNKFSIYIYIY--FFFYSFLCSPYLFKY 99 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,365,979 Number of Sequences: 5004 Number of extensions: 41078 Number of successful extensions: 79 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -