BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0712 (682 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_18512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 565 Score = 29.5 bits (63), Expect = 2.6 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -3 Query: 548 NGCPAXRTETRYCSRQK*AGRWYLPARTHKTSYH 447 N C +T+ C K WY P++T YH Sbjct: 445 NWCHPTKTQANLCHPTKTQANWYHPSKTQANWYH 478 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -3 Query: 548 NGCPAXRTETRYCSRQK*AGRWYLPARTHKTSYH 447 N C +T+ C K WY P++T YH Sbjct: 325 NWCHPTKTQACLCHPTKTQANWYHPSKTQVNWYH 358 >SB_18512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 27.9 bits (59), Expect = 8.0 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 497 ISAVSSNAFRFXGRGSRCNYTEILAFISQSGW 592 + A++ N F G RC+++E AF +S W Sbjct: 34 VGALTFNKVLFVTLGKRCDFSETPAFRKKSSW 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,964,025 Number of Sequences: 59808 Number of extensions: 313943 Number of successful extensions: 808 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -