BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0712 (682 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83109-3|CAB05515.2| 300|Caenorhabditis elegans Hypothetical pr... 30 1.3 Z68120-4|CAA92202.1| 328|Caenorhabditis elegans Hypothetical pr... 28 7.1 >Z83109-3|CAB05515.2| 300|Caenorhabditis elegans Hypothetical protein F44G3.5 protein. Length = 300 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/42 (33%), Positives = 27/42 (64%) Frame = +1 Query: 187 MLRCTIDNTLLYKIYTYIINKYFTYSYISNTFFFNYEPLLSE 312 M R +++N+L I +++++ T +YI N F+ +EP LS+ Sbjct: 205 MNRKSLENSLF--INSFVVSLLLTTNYIYNHFYLMFEPTLSQ 244 >Z68120-4|CAA92202.1| 328|Caenorhabditis elegans Hypothetical protein T24C2.4 protein. Length = 328 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +1 Query: 163 VKYKNTAGMLRCTIDNTLLYKIYTYIIN--KYFTYSYISNTFFFNYEP 300 VK+KNT ++R D T+L +Y ++ KY ++ + +FFN P Sbjct: 97 VKHKNTLKLIR---DTTILQLVYRNLVTLLKYKINTFNLSYWFFNNNP 141 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,316,356 Number of Sequences: 27780 Number of extensions: 239671 Number of successful extensions: 491 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1550199966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -