BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0712 (682 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 1.2 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 3.6 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 4.7 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 6.2 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 8.2 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/50 (22%), Positives = 23/50 (46%) Frame = +1 Query: 154 EKTVKYKNTAGMLRCTIDNTLLYKIYTYIINKYFTYSYISNTFFFNYEPL 303 ++T + ++ + ++ N Y Y N Y Y+ +N + NY+ L Sbjct: 302 DRTERERSKEPKIISSLSNNYKYSNYNNYNNNYNNYNNYNNNYNNNYKKL 351 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 248 LFIIYVYILYNNVLSMVHRNIPAVFLYFTVF 156 LF +I+Y+++ S I VFLY+ +F Sbjct: 337 LFYNTDFIIYSSLSSFYIPCIIMVFLYYNIF 367 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.2 bits (45), Expect = 4.7 Identities = 11/50 (22%), Positives = 25/50 (50%) Frame = +1 Query: 154 EKTVKYKNTAGMLRCTIDNTLLYKIYTYIINKYFTYSYISNTFFFNYEPL 303 ++T + ++ + ++ N ++ Y N Y Y+Y +N + NY+ L Sbjct: 69 DRTERERSREPKIISSLSNKTIHNNNNYNNNNYNNYNY-NNNNYNNYKKL 117 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 6.2 Identities = 9/46 (19%), Positives = 26/46 (56%) Frame = +1 Query: 157 KTVKYKNTAGMLRCTIDNTLLYKIYTYIINKYFTYSYISNTFFFNY 294 +T +Y + + + R + +++ ++ IN ++ ++Y+S + NY Sbjct: 413 RTPRYNSVSKIDRAS---RIVFPLFFLAINVFYWFAYLSRSERINY 455 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 Query: 545 RCNYTEILAFISQSGW 592 RCN T ++I GW Sbjct: 363 RCNATGAFSWIGSDGW 378 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,071 Number of Sequences: 438 Number of extensions: 3044 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -