BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0710 (593 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33404| Best HMM Match : ShTK (HMM E-Value=2.1e-10) 31 0.53 SB_41179| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_33404| Best HMM Match : ShTK (HMM E-Value=2.1e-10) Length = 251 Score = 31.5 bits (68), Expect = 0.53 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 497 YR*SHRHLNVTHHLDIR*VIETSCSGGLPSPLQIVRRY*GT 375 Y+ +H H+N +H D+R V +C L L ++ RY T Sbjct: 124 YKLNHTHVNCVYHSDVR-VKSDTCEANLIMSLDVILRYTNT 163 >SB_41179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/79 (22%), Positives = 38/79 (48%) Frame = -2 Query: 511 PSXQDTAEAIDILTSHITSTLDRSSKQVVAEDFLHRFKLSDDIRELLRAKNASXRAYDRY 332 P + + A+D++ D+++ + +AE FL L + +R + Y Y Sbjct: 102 PVINERSSALDLVHDR-GRRFDQTNLRPMAE-FLRTSSLEHTLIRGIRYLTSWSLGYTDY 159 Query: 331 PTAENRIRMRALQRDVKSR 275 P+AE + R+++R+ K + Sbjct: 160 PSAEKHDKARSVEREEKDK 178 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,192,816 Number of Sequences: 59808 Number of extensions: 281369 Number of successful extensions: 628 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -