BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0710 (593 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 7.4 AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 23 9.8 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.0 bits (47), Expect = 7.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 496 TAEAIDILTSHITSTLDRSSKQVVAEDF 413 T + + L +I T+ SSK VVA DF Sbjct: 95 TVQEFEELLDNIVLTVSGSSKFVVAGDF 122 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 22.6 bits (46), Expect = 9.8 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = -3 Query: 414 SFTASNCPTILGNSLELRTPRXAPTTGILPRKIVFECVPYNAT*SLASPKSE 259 S TAS+ G+S P + P K V C P++ +L +P+S+ Sbjct: 127 STTASSEQACSGSSSSSPEPNLDCLSKCSPTKCVPFCRPFSGQTALLTPESQ 178 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 541,285 Number of Sequences: 2352 Number of extensions: 10150 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -