BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0708 (701 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_2321| Best HMM Match : DUF1461 (HMM E-Value=2.1) 28 8.4 >SB_31800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 288 QNN-CDEYFCFRNLNSSRNGLKNYHCAGRDA 199 QNN DEYFCF +S + K +C R A Sbjct: 63 QNNIADEYFCFSQKHSKTDCRKAKNCRKRSA 93 >SB_2321| Best HMM Match : DUF1461 (HMM E-Value=2.1) Length = 340 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +1 Query: 22 LTTKTLYSKRKQYGTQSFAFLKILGIRYMRNGCL-VYRQLVMFSIKYVIAINY*MLLW 192 +T+ YSK Y T SF KI GIR N L +Y ++F+ + + LLW Sbjct: 63 ITSSKNYSKPLTYCTSSFDTNKIEGIRAQYNDALGIYLVFLVFA---SLIFGFAFLLW 117 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,149,369 Number of Sequences: 59808 Number of extensions: 459884 Number of successful extensions: 915 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 846 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 914 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -